The Echoes poetry competition to celebrate Write Out Loud's 20th anniversary is now open.  Judged by Neil Astley.

Competition closes in 10 days, 2 hours. Get details and Enter.

Recent Comments

Graham Sherwood on Giving Yourself Some Stick
1 hour ago

TOM MERTON on Watching Horses
2 hours ago

John Coopey on JOHN THE HAT
2 hours ago

Steve White on 47
4 hours ago

Stephen Atkinson on 47
4 hours ago

TOM MERTON on JOHN THE HAT
6 hours ago

TOM MERTON on Jack's Fancy
6 hours ago

TOM MERTON on Release Yourself
6 hours ago

TOM MERTON on Running With Dogs
6 hours ago

TOM MERTON on A Spiker in the works
7 hours ago

Vagabond

I know I'm not a hobo... on a train

But I feel like a vagabond... just the same.

My soul is like a wayfaring stranger,

Unable to settle down

Who's always just passing through

Going from town to town.

If I could just plant myself...

By a stream and let my roots grow...

I'd raise my branches toward the sun,

And bend when the wind does blow.

 

 

2009

Read and leave comments (0)

🌷(8)

SoulSoul SearchingRootsGod

The Evo’s Gift - Forgiven Sin

The resounding sins, of

many echo through

their etheric karma

manifesting the

good intentions, of

Personal Truth

 

at the end of the day the air waves:

find their way back home,

when the sun goes down, and

the lights go out at night

 

lightning never strikes the same place twice

however, once in a while you wonder…How? 

 

In the world we live in —

Th...

Read and leave comments (0)

🌷(4)

christmashollidaylovepoetrypoempoetpoemsnaturegodspiritualgoddessspiritualitymetaphysicsmetaphysicalocculttravelfashionmodelmakeupwedding

Where Your Soul Resides

If you sell your soul

Can you ever get it back?

Have you ever felt something

Slipping slowly from your grasp?

When that something lost is so vast

Can you just go on?

When you're in the fight of your life

And loose, can you forgive yourself?

When life's parade passes you by

Do you bother to wave?

Can you keep asking the questions

With answers too hard to face?

Ca...

Read and leave comments (0)

🌷(9)

Searching SoulsQuestionsOvercomingPeaceGod

Back To Nature

With my birdfeeder full

A bountiful supply

I think I'm giving nature a hand.

But as I watch nature unfold

It is she, that is helping me

By including me in her plan.

 

 

Read and leave comments (2)

🌷(9)

NatureBirdsGod

I Am Paint

Without you

I splatter.

I drip. I drop. I spill.

I am paint.

I conform to your will.

 

With you

I am bold, intense.

I shine.

Or I am quiet and reflective.

But I speak.

 

My life is a canvas

Ready to be filled.

I am paint...

I yield.

Read and leave comments (6)

PaintCanvasGod

The Ceiling And The Sky

In my innocence I was brave...

And knew no fear,

No boundaries, no limits, no doubts,

Unable to imagine my spirit contained.

 

The sky was open...

Then came that ceiling,

That flattened the top of my head,

And crowded my dreams with fear.

 

The ceiling was clear...

You could see right through,

Unwaivering and unmovable it sat,

Intending to crush my dreams, so...

Read and leave comments (2)

🌷(8)

Glass CeilingSkyNatureDreamsFreedomFearDoubtGod

Alone In A Crowded Stream

The driftwood floats,

Down toward the rocky slopes,

Without a care in the world.

"I can't be bothered by those jagged rocks now,

In this cool water where I enjoy my ride,"

"Besides, there's still time to turn this around,

If I could just go against the tide."

"What a life this is being driftwood,

Where I go next is anybody's guess."

So I smile like nothing's the matter,

...

Read and leave comments (0)

🌷(4)

NatureStreamDriftwoodDriftingAloneHopeMiraclesGod

Why Do Poets Ponder?

Why do poets ponder

The birds of the air...

For their beauty, their freedom, their song?

Why do they find peace in asking

Questions that begin with why?

Why are they so willing to share

The inner most part of their soul,

Hidden in symbolic mazes

With hedges high?

I guess what I'm really asking

Is why do I?

Read and leave comments (1)

🌷(9)

BirdsFreedomSongPoetsNatureWhyPonderReflectionGod

On My Wall

Ladybug, ladybug on my wall

It was there all summer, but now it's fall.

It was there all season, but never found reason

To stand and fight, or take off in flight.

It just clung there helpless.... on my wall.

Afraid to stand, afraid to fall.

 

Not really sure about its gender,

Just watched it miss out on life's spendor.

Was it waiting there for a man?

Or for someone el...

Read and leave comments (0)

🌷(5)

NatureHuman NatureBe YourselfCourageInsectsGod

This Little Bird

While most other birds sing a duet,

Or with a chorus hidden up in a tree,

There's a little bird that sings loud and proud, 

Alone, but in harmony.  

This little bird sings outside my window,

While the rest of the birds are asleep. 

This little bird sings with depth and conviction,

While others can only dream.

Where does it find the courage 

To stand alone and sing?

...

Read and leave comments (1)

🌷(8)

Birdsstand aloneBe yourselfIndividulityPoetsGodConfidenceSingHarmonyDreamDreamersFollow Your HeartCourage

Written in Stone

an epitaph
covered in overgrown grass
numbers and a letter encrypted,
written to the deceased,
for only those who knew him
you’d truly understand

Read and leave comments (0)

🌷(4)

familyfriendsdeathlovegodspiritualspiritualitynaturemetaphysicsmetaphysicaloccultpoetpoetrypoempoemswriterwriting

Hot Spring

the plumes of a caldera,
and the dark clouds,
sun overshadowed,
at its core a scalding heat turned colder
because of similarities
shared this simile
for the changing of seasons, anew
an unforgiven embrace

Read and leave comments (0)

beachsummerseasonspoetpoetrypoempoemswriterwritinglovenaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Table Manners

he wouldn’t let us leave
without paying,
for our meal

had to-go

then bantered with them
and, you ordered to make him take it back

the whole ordeal was a real headache,
I could feel tension in the temple,
and had to meditate, to
clear my head and relieve the stress

I wanted to post a pic of my meal,
but it was almost traumatic

Maybe, I’m just being over dramatic?

Read and leave comments (0)

dinnermakeuplovepoetpoetrypoempoemswriterwritingnaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultart

From doors of despair to my dear almighty

Make a painting with sweats,

And resins from plants ;sweets,

Bitters and thoughtful meets

To form its themes,

Weaved lining of lines,

Hardly the Magnum opus; it might,

But to feed it's beauty to flames,

Just to escape cold,

 And warm hands!

Am I a meaningful painting

Or just a plaything

Lying like a firewood

With no good,

 Isn't it you behind this, o almighty...

Read and leave comments (0)

🌷(1)

contemplationrantingdisillusionmentcrygodlong poemsshort stories

size them up

had me my hand me downs
and, we all know too well known
if the shoe fits wear it

nicest stuff is worn out and she wore my XXL shirt around the house
her chores, get done…
one bra in the wash and no panties on

The first steps
commemorated with expensive shoes,
soles being broken in,
a mash of burning glass,
molten sand and in it,
it’s silica content

Read and leave comments (0)

🌷(7)

cinderellaglassartworkartpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovemakeupfashionmodel

approach with caution

veered off, routine stop, in the shoulder…
looking over your paper work,
keep your hands on the steering wheel,
“I’m not going to ask again”
repeated offenses
respect my authority

police officers
a ford mustang and dodge charger

government funded electric vehicles
take a look inside the hood, it
purrs like a street cat with a scratchy throat

cut the lights on and off
I’m just try...

Read and leave comments (0)

USApolicecarpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovecreativeartartwork

phishing

attempts
online attachments
“Hooks & Worm” viruses
hosted— a parasite

on the web
spider crabs
In their net

Read and leave comments (0)

funfriendsbeachsummerpoetpoetrypoempoemswriterwritinglovequotesquotenaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultinternetviral

I Thank Both, You And My Trustworthy Lord

You have to thank, be able to thank,

For every day and every ray of the Sun.

Talk about important things and frank!

Don't ever think about using the gun.

 

 

You should be grateful for what you have.

You should thank God who gave you love.

You'll learn to live without war and grief.

You'll find out that the war is a thief.

 

 

To thank. Is it an ability or a gif...

Read and leave comments (0)

🌷(5)

Godtrustthanks

Trust in God And Don't Keep the Offences!

Don't trust the sweet words of a stranger

If you don't want to get into the danger.

Sweet words may raise you to the clouds,

But you better run away without doubts.

 

 

And having bitten into your trust like a snake,

He will be wrapped in a trustworthy fake.

And then right on your field of fight,

He will try to prove that he is right.

 

 

Neither the darkness no...

Read and leave comments (0)

🌷(5)

Godtrustoffenceflatterwords

Live Each Day As The Last

 

God presented me with a gift,

I looked at it and was surprised.

This item I couldn't manage to lift

Before I could anything realize.

 

 

Early in the morning, I made my plans.

But vanity decided to break intention.

My hopes went away with the vans.

And the prices they didn't mention.

 

 

I was quick at twenty, thirty, and so on.

I did not see the false o...

Read and leave comments (0)

🌷(7)

lifegodgift

walk the line

My turn
I’m going to
spin the bottle
no one ever even noticed me
in High School
our first kiss
needs to be perfect
you don’t get a redo

Read and leave comments (0)

🌷(6)

bottlealcoholdrinkshighschoolpartylovepoetrypoetpoempoemswriterwritingoccultmetaphysicsmetaphysicalspiritualspiritualitygodnaturemodelfashionmakeupbeauty

love-hate relationship

obsession …
— envy us
in the way they stay upsetting
themselves.

you’re setting yourself up for failure

possible optimism

two glasses
my other, half
fully blurry vision
they’re prescription
usually she has to squint
and hadn’t felt the planets tilt till now

Read and leave comments (0)

🌷(1)

mediacouplefamousmodelfashionmakeupbeautylovepoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Red Dye Number 40

in pursuit of riches
snapped twigs, and
perseverance
exhausted —
all my resources …
gone,
in the heat of the moment.

Read and leave comments (1)

🌷(2)

moneybusinessmogulfashionmakeupmodelbeautylovepoetrypoetpoempoemswriterwritinggodnaturespiritualspiritualitymetaphysicsmetaphysicaloccult

Lost Angels

martyred
Tupac Amaru Shakur
Los Angeles

thug poetry

40 ounces of malt liquor
Olde English and calligraphy

slurring my words…
sounds as if I’m speaking in cursive

Read and leave comments (0)

losangelestupaccitystatecalifornialovepoetrypoetpoempoemswriterwritingspiritualspiritualitygodnaturemetaphysicsmetaphysicaloccultbeautyfashionmakeupmodel

Welcome

take your shoes off at the door

I’ll take your coat

your hair smells refreshened
from the ozone
and
remnants of soap
lathered and rinsed out
in the rain shower

Read and leave comments (0)

fashionmakeupmodelbeautyweddingmarriedcouplelovepoetrypoetpoempoemswritingwriternaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Rhetoric

attacking my integrity

questioning… me

myself,

I, was taught there was no such thing as a stupid question

second guessing…

why?

you were impolite.

looking for answers in an inner view

Read and leave comments (0)

🌷(1)

interviewquestionsanswertruthspiritualspiritualitygodmetaphysicsmetaphysicalnatureoccultlovepoetrypoempoetpoemswritingwritermakeupfashionmodelbeauty

Stars and Stripes

big brother
little kids,
children in the middle
of
civil war torn nations

warring

civil discourse

say your prayers

“Our Father”

we gather together to ask for salvation

Read and leave comments (0)

warcivilnationUSAarmylovepoetrypoempoetwritingpoemswriternaturespiritualspiritualitygodmetaphysicsmetaphysicaloccultbeautymakeupfashionmodel

High Performance

Spun -
A burnout —
driven to madness
and
crashing,
in a
drug fueled accident

What a catastrophe!

Read and leave comments (0)

depressedhappylovequotespoetrypoempoetwriterwritingpoemsgodspiritualnaturespiritualitymetaphysicsmetaphysicaloccultfashionmakeupmodelbeauty

Infinitesimal

dimensional
cellular division
the genomic sequence

time is a light matrix
encoded in
0’s & 1’s
goes on forever …
and, in that order
10, 9.

A singularity
and absolute zero

the big freeze or heat death

he said no one can help us
when, asking the universe
for answers

what, times any number
… is nothing other than zero

Read and leave comments (0)

🌷(5)

mathmathematicsschoolpoetpoetrypoempoemswritingwriterusanaturelovefashionmakeupbeautyspiritualspiritualitymetaphysicsmetaphysicaloccultgod

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

🌷(1)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Family Ties

ancestors
shackled
and put in line
following the customs
of those, who
came before them
 

Read and leave comments (0)

natureUSAgodspiritualspiritualitymetaphysicslovepoetrypoetpoempoemswritingwriterbeautymakeupfashion

Moral Support

We shouldn’t be embarrassed
to talk
…. about our problems
to a therapist

always looking at me, before you speak

I’m here for —You
if ever
you feel the need to talk about anything.

Read and leave comments (0)

therapydepressionmentalhealthlovepoetrypoetpoemwriterwritingmetaphysicsoccultgodUSAfashionmakeupbeautynature

Trojan Horse

Generation X
plagued
with
this ease
that is,
going viral…

Read and leave comments (0)

sexlovebabyspiritualspiritualitymetaphysicsgodcreationpoetpoetrypoempoemswritingwriternaturefashionmakeupbeauty

Web of Lies

Paralyzed
like a spider
checking in on his victim
tied up, entangled …
makes me think
of a bad dream
worsened
the familiar feeling of
waking up to the news of death

Read and leave comments (0)

spiderbugsnaturegodspiritualspiritualitymetaphysicsoccultUSApoetpoetrypoempoemswriterwritingfashionmakeupbeauty

smooth...

They say he has his way with the ladies
the bruiser at the door
thought to himself
hey, let’s not get carried away

what a light weight ...
they had been seen leaving together
after a fight—being broken up
over a year at least

she said to all her girlfriends
“it was like I was blinking
then my eyes rolled back
into my head and everything went black”

Read and leave comments (0)

alcoholbardrinklovegodspiritualityspiritualmetaphysicsnaturepoetpoetrypoempoemswritingwriterfashionmakeupbeauty

Bible on a night stand

intermingling with a demon in the flesh
you realize your life was a lie
and your soul suffers in hell
for what feels like an eternal
date with death

Read and leave comments (0)

godspiritualitybiblespiritualmetaphysicsoccultnaturelovepoetpoetrypoempoemswriterwritingUSAfashionmakeupbeauty

Ebonics

A child
talking black
to their parents
acting out of character
arguing about upbringing
taken back
some things are best left unsaid…

Read and leave comments (0)

USAcrimeamericapoetrypoempoemspoetwriterwritinglovenaturegodspiritualspiritualitymetaphysicsmakeupbeautyfashion

Dark Side of the Moon

prophesied
the premonitions
foreshadow people
who live lives with
similarities parallel to our very own

when your third eye intakes light
and all the shades disappear in the night
their life is vibrant
the dream seen as an auric phenomenon
it’s either that
Or, are you completely isolated
in the back of the black of your eyelids

see an oracle or dream interpreter,
our aura’s rainbo...

Read and leave comments (0)

natureusagodspiritualitymetaphysicsspiritualpoetpoempoetrypoemswritingwriterlovemakeupfashionbeauty

Fog of War

smoking barrels
in talks —about the past
around the campfire

you could cut the tension with a knife

the only thing needed is a good sense of humor

And,
…try not to lose your self along the way

the buddy system
marching—
side by side
do you trust that man with your life?
willing to take a bullet for them?
behind every great man is a great woman…

Read and leave comments (0)

warusacrimearmylovepoetpoetrypoemwriterwritingnaturemetaphysicsspiritualitygodmakeupfashionbeauty

Sweating in my Sleep

This is a dream full of desires,
and I like to think
when we go to sleep eternally

our soul
will not be without
the rest in heaven.

Read and leave comments (0)

naturelovepoetrypoempoemspoetwritingwritergodspiritualspiritualitymetaphysicalmetaphysicsmakeupfashionbeauty

Dubbed Subtitles

what I say goes —
if I say so -
don’t allow an application to control anything
they need permission in these settings
and turn down your background music
“for what?”
if I’m going to green light your on screen time

we cannot have anyone getting an extreme close up
portray a picture perfect image

believe me...

flash forward,
when you’re using the front camera shutter you’ll see

y...

Read and leave comments (0)

🌷(4)

spiritualspiritualitygodmetaphysicsnaturelovepoetpoetrypoemfashionmakeupbeauty

To The Creator

You are with me in grief and happiness,
You are with me in joy and loneliness,
You are the One who gives me shelter and support,
You are my love and my reward.


You are the beginning and the end,
There is no one you ever offend.
You are my consolation,
You are my celebration,
You are my light
In the dark night.


In my perishable heart
I find the answers with your help,
You tell m...

Read and leave comments (2)

🌷(6)

god

Creature of Habit

at times I find myself
with insight
into my third eye
the inward perception
of crystalline tears
holding onto emotions
looking for one thing

The truth

Read and leave comments (0)

🌷(9)

naturedepressedsadlovepoetpoetrypoemgodspiritualspiritualitymetaphysicsmetaphysicalawakeningtruthbeautymakeup

Waxing Poetic

my love letter
stamped with a pair of pressed lips
licked,
then sealed with a kiss

the silent observer.
waiting for his moment
with the present

trying quietly not to mouth breathe aloud
smothered in your undergarments

while fire from the two flames
arose
on a magic candle
over and over

like a brazier come undone

Read and leave comments (0)

lingerieloveprettybeautyfashionpoempoetrypoetnaturegodspiritualspiritualitymetaphysicsmetaphysical

The Vacuum of Space

star dust -
quantum particles —

and, strings ...
from the fabric of the universe

ashes to ashes,
A bindi
black glasses,
fragmented obsidian
and, an asteroid belt

A Shero
— deified
hereafter she received
Saturn’s ring.

Read and leave comments (0)

spacecosmosastrologyspiritualspiritualitymetaphysicsmetaphysicalgodnaturelovepoempoetpoetrybeautyfashion

We Took a Wrong turn

You know what ?
they say,
three lefts make a right.

I’ll go ahead
and, uh…
double back around

now, where were we

we’re here

Where?

There.

well.. then,
why didn’t you just tell me that in the first place

Read and leave comments (0)

streetcartravelnaturelovepoempoetpoetrygodspiritualspiritualitymetaphysicsmetaphysical

Dead End

you need to
... stop
ignoring ...
the warning signs to
turn around your life

Read and leave comments (0)

carstreetlovepoempoetpoetrynaturegodspiritualspiritualitymetaphysicsmetaphysical

Bullet Points

This just in
The faulty firing pin — from a fire arm
had become dislodged
effectively,
causing it to misfire

very briefly …
in acceptance of all responsibility
the city-state committee
has sent a representative
that will be answering questions

now… back to you

in other news
we have a sunny forecast

there’s a color shader
right there, on
this heat map
that has an infrared si...

Read and leave comments (0)

gunsafetyfirearmsusalovepeacefreedomcrimemetaphysicsmetaphysicalspiritualspiritualitynaturegodpoempoetrypoet

Spiritual Anima

human nature and
sympathetic sensitivity

parasitic

thought forms and will
manifest in woman and child

more so

than the inward hatred from a negative mentality

Read and leave comments (0)

animalnaturespiritspiritualspiritualitywriterpoempoetrypoetlovegodmetaphysics

Show more entries …

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message