Donations are essential to keep Write Out Loud going    

metaphysical (Remove filter)

Recent Comments

Marla Joy on Lions Land.
2 hours ago

Greg Freeman on Dominoes
2 hours ago

M.C. Newberry on Combe Gibbet
3 hours ago

Ian Whiteley on Citizens
3 hours ago

M.C. Newberry on Sashaying to Byzantium
3 hours ago

M.C. Newberry on IT AIN'T ME, BABE
3 hours ago

Auracle on Festive FM
4 hours ago

Tim Higbee on Grandfather
5 hours ago

TobaniNataiella on She Says Goodbye
6 hours ago

R A Porter on Sashaying to Byzantium
9 hours ago

Written in Stone

an epitaph
covered in overgrown grass
numbers and a letter encrypted,
written to the deceased,
for only those who knew him
you’d truly understand

Read and leave comments (0)

🌷(4)

familyfriendsdeathlovegodspiritualspiritualitynaturemetaphysicsmetaphysicaloccultpoetpoetrypoempoemswriterwriting

Hot Spring

the plumes of a caldera,
and the dark clouds,
sun overshadowed,
at its core a scalding heat turned colder
because of similarities
shared this simile
for the changing of seasons, anew
an unforgiven embrace

Read and leave comments (0)

beachsummerseasonspoetpoetrypoempoemswriterwritinglovenaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Table Manners

he wouldn’t let us leave
without paying,
for our meal

had to-go

then bantered with them
and, you ordered to make him take it back

the whole ordeal was a real headache,
I could feel tension in the temple,
and had to meditate, to
clear my head and relieve the stress

I wanted to post a pic of my meal,
but it was almost traumatic

Maybe, I’m just being over dramatic?

Read and leave comments (0)

dinnermakeuplovepoetpoetrypoempoemswriterwritingnaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultart

size them up

had me my hand me downs
and, we all know too well known
if the shoe fits wear it

nicest stuff is worn out and she wore my XXL shirt around the house
her chores, get done…
one bra in the wash and no panties on

The first steps
commemorated with expensive shoes,
soles being broken in,
a mash of burning glass,
molten sand and in it,
it’s silica content

Read and leave comments (0)

🌷(7)

cinderellaglassartworkartpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovemakeupfashionmodel

approach with caution

veered off, routine stop, in the shoulder…
looking over your paper work,
keep your hands on the steering wheel,
“I’m not going to ask again”
repeated offenses
respect my authority

police officers
a ford mustang and dodge charger

government funded electric vehicles
take a look inside the hood, it
purrs like a street cat with a scratchy throat

cut the lights on and off
I’m just try...

Read and leave comments (0)

USApolicecarpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovecreativeartartwork

phishing

attempts
online attachments
“Hooks & Worm” viruses
hosted— a parasite

on the web
spider crabs
In their net

Read and leave comments (0)

funfriendsbeachsummerpoetpoetrypoempoemswriterwritinglovequotesquotenaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultinternetviral

walk the line

My turn
I’m going to
spin the bottle
no one ever even noticed me
in High School
our first kiss
needs to be perfect
you don’t get a redo

Read and leave comments (0)

🌷(6)

bottlealcoholdrinkshighschoolpartylovepoetrypoetpoempoemswriterwritingoccultmetaphysicsmetaphysicalspiritualspiritualitygodnaturemodelfashionmakeupbeauty

love-hate relationship

obsession …
— envy us
in the way they stay upsetting
themselves.

you’re setting yourself up for failure

possible optimism

two glasses
my other, half
fully blurry vision
they’re prescription
usually she has to squint
and hadn’t felt the planets tilt till now

Read and leave comments (0)

🌷(1)

mediacouplefamousmodelfashionmakeupbeautylovepoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Red Dye Number 40

in pursuit of riches
snapped twigs, and
perseverance
exhausted —
all my resources …
gone,
in the heat of the moment.

Read and leave comments (1)

🌷(2)

moneybusinessmogulfashionmakeupmodelbeautylovepoetrypoetpoempoemswriterwritinggodnaturespiritualspiritualitymetaphysicsmetaphysicaloccult

Lost Angels

martyred
Tupac Amaru Shakur
Los Angeles

thug poetry

40 ounces of malt liquor
Olde English and calligraphy

slurring my words…
sounds as if I’m speaking in cursive

Read and leave comments (0)

losangelestupaccitystatecalifornialovepoetrypoetpoempoemswriterwritingspiritualspiritualitygodnaturemetaphysicsmetaphysicaloccultbeautyfashionmakeupmodel

Welcome

take your shoes off at the door

I’ll take your coat

your hair smells refreshened
from the ozone
and
remnants of soap
lathered and rinsed out
in the rain shower

Read and leave comments (0)

fashionmakeupmodelbeautyweddingmarriedcouplelovepoetrypoetpoempoemswritingwriternaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Rhetoric

attacking my integrity

questioning… me

myself,

I, was taught there was no such thing as a stupid question

second guessing…

why?

you were impolite.

looking for answers in an inner view

Read and leave comments (0)

🌷(1)

interviewquestionsanswertruthspiritualspiritualitygodmetaphysicsmetaphysicalnatureoccultlovepoetrypoempoetpoemswritingwritermakeupfashionmodelbeauty

Stars and Stripes

big brother
little kids,
children in the middle
of
civil war torn nations

warring

civil discourse

say your prayers

“Our Father”

we gather together to ask for salvation

Read and leave comments (0)

warcivilnationUSAarmylovepoetrypoempoetwritingpoemswriternaturespiritualspiritualitygodmetaphysicsmetaphysicaloccultbeautymakeupfashionmodel

High Performance

Spun -
A burnout —
driven to madness
and
crashing,
in a
drug fueled accident

What a catastrophe!

Read and leave comments (0)

depressedhappylovequotespoetrypoempoetwriterwritingpoemsgodspiritualnaturespiritualitymetaphysicsmetaphysicaloccultfashionmakeupmodelbeauty

Infinitesimal

dimensional
cellular division
the genomic sequence

time is a light matrix
encoded in
0’s & 1’s
goes on forever …
and, in that order
10, 9.

A singularity
and absolute zero

the big freeze or heat death

he said no one can help us
when, asking the universe
for answers

what, times any number
… is nothing other than zero

Read and leave comments (0)

🌷(5)

mathmathematicsschoolpoetpoetrypoempoemswritingwriterusanaturelovefashionmakeupbeautyspiritualspiritualitymetaphysicsmetaphysicaloccultgod

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

🌷(1)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Sweating in my Sleep

This is a dream full of desires,
and I like to think
when we go to sleep eternally

our soul
will not be without
the rest in heaven.

Read and leave comments (0)

naturelovepoetrypoempoemspoetwritingwritergodspiritualspiritualitymetaphysicalmetaphysicsmakeupfashionbeauty

Creature of Habit

at times I find myself
with insight
into my third eye
the inward perception
of crystalline tears
holding onto emotions
looking for one thing

The truth

Read and leave comments (0)

🌷(9)

naturedepressedsadlovepoetpoetrypoemgodspiritualspiritualitymetaphysicsmetaphysicalawakeningtruthbeautymakeup

Waxing Poetic

my love letter
stamped with a pair of pressed lips
licked,
then sealed with a kiss

the silent observer.
waiting for his moment
with the present

trying quietly not to mouth breathe aloud
smothered in your undergarments

while fire from the two flames
arose
on a magic candle
over and over

like a brazier come undone

Read and leave comments (0)

lingerieloveprettybeautyfashionpoempoetrypoetnaturegodspiritualspiritualitymetaphysicsmetaphysical

The Vacuum of Space

star dust -
quantum particles —

and, strings ...
from the fabric of the universe

ashes to ashes,
A bindi
black glasses,
fragmented obsidian
and, an asteroid belt

A Shero
— deified
hereafter she received
Saturn’s ring.

Read and leave comments (0)

spacecosmosastrologyspiritualspiritualitymetaphysicsmetaphysicalgodnaturelovepoempoetpoetrybeautyfashion

We Took a Wrong turn

You know what ?
they say,
three lefts make a right.

I’ll go ahead
and, uh…
double back around

now, where were we

we’re here

Where?

There.

well.. then,
why didn’t you just tell me that in the first place

Read and leave comments (0)

streetcartravelnaturelovepoempoetpoetrygodspiritualspiritualitymetaphysicsmetaphysical

Dead End

you need to
... stop
ignoring ...
the warning signs to
turn around your life

Read and leave comments (0)

carstreetlovepoempoetpoetrynaturegodspiritualspiritualitymetaphysicsmetaphysical

Bullet Points

This just in
The faulty firing pin — from a fire arm
had become dislodged
effectively,
causing it to misfire

very briefly …
in acceptance of all responsibility
the city-state committee
has sent a representative
that will be answering questions

now… back to you

in other news
we have a sunny forecast

there’s a color shader
right there, on
this heat map
that has an infrared si...

Read and leave comments (0)

gunsafetyfirearmsusalovepeacefreedomcrimemetaphysicsmetaphysicalspiritualspiritualitynaturegodpoempoetrypoet

Symbiosis of Broken Hearts

What is love?
Besides “A”
— a couple of
vowel sounds,
between U & I

ouïe?

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualitymetaphysicsmetaphysicaloccultspiritual

Star seeds ‘n’ the Cosmic egg - of life

Dewy lotuses, 
grow in the dark -
creating an entangling —
Flower of Life …

nature and everything — we know — has its roots
on the grounds of truth
indeed…
every family tree,
needs...
a tree house.

Habitats for Humanity  

There is a lone wolf
which is black,
and blue,
in the eyes :
whom sees the world differently
depending on —
whether or not you’re 
— on his or her good or...

Read and leave comments (0)

🌷(3)

birthdayhappybirthdayoccultmetaphysicsspiritualmetaphysicalnaturelovepoempoetrypoetspiritualitygodtruth

The Great Window

I sit quiet, smoked out with sage and gratitude, love overwhelmed.  Of course, for God and Christ, white crystals and frankincense, and high frequency vibration ever rising, but most of my thoughts are of you.

I’m grateful…

For our teach-learn/learn-teaching.  It pushes through and sheds light and mostly – it paints.

With wide colorful strokes, our shadow projects into the ethers and I se...

Read and leave comments (0)

🌷(4)

metaphysicalloveuniversefuture

The Coming of a New Age

With every year's end - the advent marks the start of a new day,
as human kind we’re always growing wiser, furthermore, fully face to face with the task of taking baby steps toward a straight forward path —
It’s time to take a stand…
(With that being said: we really need to enjoy such a joyous occasion)
In an effort to boost morale; International Women’s Day should pronounce a two part holiday...

Read and leave comments (0)

🌷(1)

Naturefeminismfashionspiritualitygodlovepoempoetrylove poemspiritualmetaphysicsmetaphysical poetrymetaphysical

To a Late Friend

No more asking of “what” and “why”;

As always, silence replaces the weeping.

I keep repeating that you are not alive,

But you are not dead either, you are just sleeping.

I hear your steps on the staircase,

Your voice rushes in, then, the smell of your hair.

You smile at me, and I look through your face

As the cold of eternity fills up the air

And rests on the lifeless face ...

Read and leave comments (0)

deathfriendshiplifemetaphysical

Half-life half-lived

I cut an apple

In two halves precisely.

Now how do I choose

The finer half?

Life is made up of

Half-truths and half-lies

And then of the almosts.

My half-live half-lived…

The other half is still

Inside the magician’s hat.

Read and leave comments (0)

philisophicalmetaphysical

The time is crawling

The time is crawling

On this slippery Friday afternoon.

My body is trapped

In an hourglass room.

My poor empty body

Can no longer feel the pain.

There is a dry flower

In the corner.

I have been staring at it

For the past hour.

Does it crave love

That I can no longer give?

Read and leave comments (0)

🌷(1)

philosophicalmetaphysicalsentimental

I'd always been part of you

It was me whose glimpse you caught

Hurrying,

Turning around the corner,

Wishing to go unnoticed.

It was me you felt

Sifting through your fingers

Like sand at dusk,

Sitting alone on the shore...

It was me you smelled

Walking through the autumn orchards,

Through the sunlit prairies,

Through the second-hand bookstores.

It was me you tasted,

When you bit an unexp...

Read and leave comments (0)

🌷(1)

lovemetaphysical

Luule #1

Poetry, heavy words for all souls that want to be free,

it's the burning sun above the dead trees with no leaves,

saluting all the real ones and the OGs that people ought to be,

running wild chained thoughts with no minds is what they seek,

watching people burn from the white fire trying to flee,

as the damned creatures banned from Heaven have nothing left but to go down on their kn...

Read and leave comments (1)

🌷(3)

metaphysicalphilosophylife

Illumination

occult curriculum, whispers of the ancients, leave for letting out secrets
oil lamp kindling catching flames; shining begotten light from passerbys
in between classes, shifting penrose stairs lead into underlying framework on occasion
halls lined with rooks adjacent and curators searching for a select
rites of secret passageways proclaimed, karma to the dark is just a means to an end
time and...

Read and leave comments (0)

beautygodilluminationlightlovelove poemsmetaphysicalmetaphysicsmusicnaturepoempoemspoetrysciencesoundspiritualspirituality

spirit assortment

Shining ever so bright
a beacon of hope, like a chinese lantern
photosynthesis get' me through the night
beauty so divine, i wonder if i could map her
would the geometry show me the light?
because she must be god's best work

my third eye look through the peephole
how can she not have walls up when she deals with these people
guide me, be my mentor
would you take my hand, and put this fl...

Read and leave comments (1)

🌷(2)

lovelove poemlove poemsmetaphysicalmetaphysicsOasispoemspiritualitywater

Matriarch

 

Matriarch butterfly, conduct conducive
mother gaia's demeanor echo.
as you move mountains

as she size your shoe, electrifying presence
you're so well grounded
heart fluttering, don't be disheartened.
trumpets erupting, as you walk the walk, my mind carry off as I'm wrapped in your minutiae

Shift the world, your tectonic occupancy lay rise to volumes of topographic novelties
distin...

Read and leave comments (0)

Matriarchlove poemloverslovelove poemsspiritualitynatureearthmetaphysicalmetaphysics

Out of body

You know that you are having

An out of body experience

When you find

Your heart and your mind

In a different place

To where you physically

Are

Read and leave comments (5)

🌷(3)

metaphysicalmicropoem

SECRETS

The night 
has some secrets.

It is still burning 
in spite of 
its deep burns.

It shows 
it has received
those.

It confuses us
with some
cottons.

Read and leave comments (0)

metaphysicalsurreal

HONEST FACE

Tell me woman, who is more honest:

The face who smiles, with bright murderers standing in lines,
covertly grinning, 'love exists, but in ways',

the face who cannot smile, even if it's smiling
as his beautiful eyes, now grown up flames, increasing their shape
in a strong kiss that bends two forests,

the face who lives through a fair winter
and claims, it hasn't cried
and the banks whe...

Read and leave comments (0)

existentialismmetaphysical

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message