Donations are essential to keep Write Out Loud going    

nature (Remove filter)

Recent Comments

Graham Sherwood on Giant Blue Star
49 minutes ago

Stephen Gospage on October Rain
1 hour ago

Stephen Gospage on Never
1 hour ago

Stephen Gospage on Renew
1 hour ago

Reggie's Ghost on Giant Blue Star
5 hours ago

Graham Sherwood on Never
12 hours ago

TobaniNataiella on Magic Three Words
16 hours ago

raypool on HUNTER'S MOON
17 hours ago

Tom Doolan on October Rain
19 hours ago

Red Brick Keshner on This All Dies
1 day ago

walk the line

My turn
I’m going to
spin the bottle
no one ever even noticed me
in High School
our first kiss
needs to be perfect
you don’t get a redo

Read and leave comments (0)

🌷(1)

bottlealcoholdrinkshighschoolpartylovepoetrypoetpoempoemswriterwritingoccultmetaphysicsmetaphysicalspiritualspiritualitygodnaturemodelfashionmakeupbeauty

love-hate relationship

obsession …
— envy us
in the way they stay upsetting
themselves.

you’re setting yourself up for failure

possible optimism

two glasses
my other, half
fully blurry vision
they’re prescription
usually she has to squint
and hadn’t felt the planets tilt till now

Read and leave comments (0)

mediacouplefamousmodelfashionmakeupbeautylovepoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Red Dye Number 40

in pursuit of riches
snapped twigs, and
perseverance
exhausted —
all my resources …
gone,
in the heat of the moment.

Read and leave comments (0)

moneybusinessmogulfashionmakeupmodelbeautylovepoetrypoetpoempoemswriterwritinggodnaturespiritualspiritualitymetaphysicsmetaphysicaloccult

Lost Angels

martyred
Tupac Amaru Shakur
Los Angeles

thug poetry

40 ounces of malt liquor
Olde English and calligraphy

slurring my words…
sounds as if I’m speaking in cursive

Read and leave comments (0)

losangelestupaccitystatecalifornialovepoetrypoetpoempoemswriterwritingspiritualspiritualitygodnaturemetaphysicsmetaphysicaloccultbeautyfashionmakeupmodel

Welcome

take your shoes off at the door

I’ll take your coat

your hair smells refreshened
from the ozone
and
remnants of soap
lathered and rinsed out
in the rain shower

Read and leave comments (0)

fashionmakeupmodelbeautyweddingmarriedcouplelovepoetrypoetpoempoemswritingwriternaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Rhetoric

attacking my integrity

questioning… me

myself,

I, was taught there was no such thing as a stupid question

second guessing…

why?

you were impolite.

looking for answers in an inner view

Read and leave comments (0)

interviewquestionsanswertruthspiritualspiritualitygodmetaphysicsmetaphysicalnatureoccultlovepoetrypoempoetpoemswritingwritermakeupfashionmodelbeauty

Stars and Stripes

big brother
little kids,
children in the middle
of
civil war torn nations

warring

civil discourse

say your prayers

“Our Father”

we gather together to ask for salvation

Read and leave comments (0)

warcivilnationUSAarmylovepoetrypoempoetwritingpoemswriternaturespiritualspiritualitygodmetaphysicsmetaphysicaloccultbeautymakeupfashionmodel

High Performance

Spun -
A burnout —
driven to madness
and
crashing,
in a
drug fueled accident

What a catastrophe!

Read and leave comments (0)

depressedhappylovequotespoetrypoempoetwriterwritingpoemsgodspiritualnaturespiritualitymetaphysicsmetaphysicaloccultfashionmakeupmodelbeauty

Renew

The trees begin to wilt and fade;

Another year is on the fall.

Though autumn can defy the odds,

The winter’s cold is bound to call.

 

The daytime’s relegated role

Is limited to minor parts;

Discarded leaves drift down to earth

In patterns of the purest arts.

 

In nights replete with cloudless chill,

We shiver at the crisp-cut moon;

The powdered snow beneath our ...

Read and leave comments (5)

Seasonsnature

Mother Nature Appears To Be A Saint.

Autumn turned into the red October.

It made a fire out of colorful leaves.

It wasn't cold but turned into amber.

In rains and winds, it only believes.

 

 

In October Autumn has become just crazy.

In October Autumn has become a bit lazy.

Walking sadly, weeping with a lot of tears,

Hiding carefully its reddish face and fears.

 

 

The thoughts of crazy October torm...

Read and leave comments (2)

autumnnature

Infinitesimal

dimensional
cellular division
the genomic sequence

time is a light matrix
encoded in
0’s & 1’s
goes on forever …
and, in that order
10, 9.

A singularity
and absolute zero

the big freeze or heat death

he said no one can help us
when, asking the universe
for answers

what, times any number
… is nothing other than zero

Read and leave comments (0)

🌷(5)

mathmathematicsschoolpoetpoetrypoempoemswritingwriterusanaturelovefashionmakeupbeautyspiritualspiritualitymetaphysicsmetaphysicaloccultgod

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

🌷(1)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Family Ties

ancestors
shackled
and put in line
following the customs
of those, who
came before them
 

Read and leave comments (0)

natureUSAgodspiritualspiritualitymetaphysicslovepoetrypoetpoempoemswritingwriterbeautymakeupfashion

Moral Support

We shouldn’t be embarrassed
to talk
…. about our problems
to a therapist

always looking at me, before you speak

I’m here for —You
if ever
you feel the need to talk about anything.

Read and leave comments (0)

therapydepressionmentalhealthlovepoetrypoetpoemwriterwritingmetaphysicsoccultgodUSAfashionmakeupbeautynature

Trojan Horse

Generation X
plagued
with
this ease
that is,
going viral…

Read and leave comments (0)

sexlovebabyspiritualspiritualitymetaphysicsgodcreationpoetpoetrypoempoemswritingwriternaturefashionmakeupbeauty

Web of Lies

Paralyzed
like a spider
checking in on his victim
tied up, entangled …
makes me think
of a bad dream
worsened
the familiar feeling of
waking up to the news of death

Read and leave comments (0)

spiderbugsnaturegodspiritualspiritualitymetaphysicsoccultUSApoetpoetrypoempoemswriterwritingfashionmakeupbeauty

smooth...

They say he has his way with the ladies
the bruiser at the door
thought to himself
hey, let’s not get carried away

what a light weight ...
they had been seen leaving together
after a fight—being broken up
over a year at least

she said to all her girlfriends
“it was like I was blinking
then my eyes rolled back
into my head and everything went black”

Read and leave comments (0)

alcoholbardrinklovegodspiritualityspiritualmetaphysicsnaturepoetpoetrypoempoemswritingwriterfashionmakeupbeauty

Bible on a night stand

intermingling with a demon in the flesh
you realize your life was a lie
and your soul suffers in hell
for what feels like an eternal
date with death

Read and leave comments (0)

godspiritualitybiblespiritualmetaphysicsoccultnaturelovepoetpoetrypoempoemswriterwritingUSAfashionmakeupbeauty

Ebonics

A child
talking black
to their parents
acting out of character
arguing about upbringing
taken back
some things are best left unsaid…

Read and leave comments (0)

USAcrimeamericapoetrypoempoemspoetwriterwritinglovenaturegodspiritualspiritualitymetaphysicsmakeupbeautyfashion

Dark Side of the Moon

prophesied
the premonitions
foreshadow people
who live lives with
similarities parallel to our very own

when your third eye intakes light
and all the shades disappear in the night
their life is vibrant
the dream seen as an auric phenomenon
it’s either that
Or, are you completely isolated
in the back of the black of your eyelids

see an oracle or dream interpreter,
our aura’s rainbo...

Read and leave comments (0)

natureusagodspiritualitymetaphysicsspiritualpoetpoempoetrypoemswritingwriterlovemakeupfashionbeauty

Fog of War

smoking barrels
in talks —about the past
around the campfire

you could cut the tension with a knife

the only thing needed is a good sense of humor

And,
…try not to lose your self along the way

the buddy system
marching—
side by side
do you trust that man with your life?
willing to take a bullet for them?
behind every great man is a great woman…

Read and leave comments (0)

warusacrimearmylovepoetpoetrypoemwriterwritingnaturemetaphysicsspiritualitygodmakeupfashionbeauty

Sweating in my Sleep

This is a dream full of desires,
and I like to think
when we go to sleep eternally

our soul
will not be without
the rest in heaven.

Read and leave comments (0)

naturelovepoetrypoempoemspoetwritingwritergodspiritualspiritualitymetaphysicalmetaphysicsmakeupfashionbeauty

My Way

A yellow leaf broke away from the tree. 

He thought he could live now free.

But it happened a quite different way,

Without a trunk, he could helplessly lay.

 

Laying lonely far from the trunk

He was feeling a little bit drunk.

Even though the others were around,

His happiness was not found.


 

I  wandered on the fallen leaves in the forest,

And the weather looked ...

Read and leave comments (1)

🌷(8)

natureleavestreelife

The Autumn And The Rain

Wearing a gray raincoat, with an unsteady walk,

The rain was so sad and didn't want to talk.

He remembered those sweet and beautiful days

When the butterflies flew among the warm bays.

 

 

He remembered a nightingale singing a song

And it looked as if nothing was wrong.

Now autumn melancholy and sadness

Replaced the joy of summer happiness.

 

 

The rain came acr...

Read and leave comments (4)

🌷(8)

natureautumnrain

: The Barren Tree :

It grew in the wilds, a sentinel growing tall,

A mighty yogi in presence, embracing it all!

Branches reaching out, to the skies in a plea,

Seeking for the strength - to live it's destiny!

 

Its ancient bark, a wrinkled, weathered hide,

Tells a tale of the time's, swiftly flowing tide.

Inexorably which has grabbed, life in a churn,

On and onwards to - the lands of no return!

...

Read and leave comments (3)

🌷(7)

TreeMusesBarrenLifeNatureAncientPoetry

Dubbed Subtitles

what I say goes —
if I say so -
don’t allow an application to control anything
they need permission in these settings
and turn down your background music
“for what?”
if I’m going to green light your on screen time

we cannot have anyone getting an extreme close up
portray a picture perfect image

believe me...

flash forward,
when you’re using the front camera shutter you’ll see

y...

Read and leave comments (0)

🌷(4)

spiritualspiritualitygodmetaphysicsnaturelovepoetpoetrypoemfashionmakeupbeauty

Previous skins

Five years ago flew by

Now, already remote

The rolling of the years

They’re already afloat

Your past self

Already a ghost

 

When you stand still

You begin to grieve your previous skins

Wonder why you had to forget and kill

Old personalities just to multiply new

So, you cling on to specific moments

Promise not to forget, you never will

 

But it is not uniqu...

Read and leave comments (4)

🌷(8)

memorylifepresentpastfuturetensesjourneyagingnaturelivespreviouspast liferememberidentitybrainconnectionmemory lossforgetrebirthmomentghostyearsmeaninglet gohold on

Creature of Habit

at times I find myself
with insight
into my third eye
the inward perception
of crystalline tears
holding onto emotions
looking for one thing

The truth

Read and leave comments (0)

🌷(9)

naturedepressedsadlovepoetpoetrypoemgodspiritualspiritualitymetaphysicsmetaphysicalawakeningtruthbeautymakeup

Waxing Poetic

my love letter
stamped with a pair of pressed lips
licked,
then sealed with a kiss

the silent observer.
waiting for his moment
with the present

trying quietly not to mouth breathe aloud
smothered in your undergarments

while fire from the two flames
arose
on a magic candle
over and over

like a brazier come undone

Read and leave comments (0)

lingerieloveprettybeautyfashionpoempoetrypoetnaturegodspiritualspiritualitymetaphysicsmetaphysical

The Vacuum of Space

star dust -
quantum particles —

and, strings ...
from the fabric of the universe

ashes to ashes,
A bindi
black glasses,
fragmented obsidian
and, an asteroid belt

A Shero
— deified
hereafter she received
Saturn’s ring.

Read and leave comments (0)

spacecosmosastrologyspiritualspiritualitymetaphysicsmetaphysicalgodnaturelovepoempoetpoetrybeautyfashion

We Took a Wrong turn

You know what ?
they say,
three lefts make a right.

I’ll go ahead
and, uh…
double back around

now, where were we

we’re here

Where?

There.

well.. then,
why didn’t you just tell me that in the first place

Read and leave comments (0)

streetcartravelnaturelovepoempoetpoetrygodspiritualspiritualitymetaphysicsmetaphysical

Dead End

you need to
... stop
ignoring ...
the warning signs to
turn around your life

Read and leave comments (0)

carstreetlovepoempoetpoetrynaturegodspiritualspiritualitymetaphysicsmetaphysical

Bullet Points

This just in
The faulty firing pin — from a fire arm
had become dislodged
effectively,
causing it to misfire

very briefly …
in acceptance of all responsibility
the city-state committee
has sent a representative
that will be answering questions

now… back to you

in other news
we have a sunny forecast

there’s a color shader
right there, on
this heat map
that has an infrared si...

Read and leave comments (0)

gunsafetyfirearmsusalovepeacefreedomcrimemetaphysicsmetaphysicalspiritualspiritualitynaturegodpoempoetrypoet

stigma of a damselfly

the woodland hoarfrost dressing tendrils
 could no less love the light;
it is in this very conflict I find myself
in cavernous worship to both sides,
this delicate balance of paradox,
pirouetting on a sheet of glass,
untinged
by the busy of the world,
alive in its own concention.

Read and leave comments (0)

🌷(2)

poemofthedaynatureamwritingparadoxlovefeelsomethingdelicate

Entwined

Let me search for a lonesome tree,

For little old lonesome me

To give some quiet company.

 

Let my body replace

The absence of its leaves.

Let the wind caress my skin,

As tenderly as it would the leaves.

 

And when the day awakes,

With the sun peeking up

from beneath its covers,

Let a singular shadow be cast.

Of a hanged man and a tree,

Keeping e...

Read and leave comments (0)

🌷(4)

suicidelonelinessnaturecompany

Spiritual Anima

human nature and
sympathetic sensitivity

parasitic

thought forms and will
manifest in woman and child

more so

than the inward hatred from a negative mentality

Read and leave comments (0)

animalnaturespiritspiritualspiritualitywriterpoempoetrypoetlovegodmetaphysics

Déjà vu & Phantasmagoria

— Recurring

crime seen in your eyes,
reflecting - eyelids
singed… deep, froze
and framed with pain
the negatives
of a photographic memory,
an outlook not unlike,
questioning, asking myself
what have I done?
what am I doing with my life?
what could I have done different?

Read and leave comments (0)

🌷(1)

crimethrillerlovepassionpoempoetrypoetwriternaturegodspiritualspiritualitymetaphysics

traffic & drugs

cats pests and insecticides
labrador dog breed
strands of
grass and dirt weed

Read and leave comments (0)

🌷(3)

cheech and chongmoviescriptpoempoetrypoetpoemslovenaturemetaphysicsweedcannabisdrugsgodspiritual

11:11

In the first second
infinite sensory overload
will begin, download it
and then this
thought process …
it is up to you to utilize
the central nervous system’s data

our own eye of the storm
strike like
lightning …
fast reflexes at the hands
of centered command

Read and leave comments (0)

11:11timeclockmagicspiritualnaturemetaphysicsgodpoetpoetrypoempoemswriterlove

reincarceration

serving consecutive life sentences
three meals,
the confines of jail time
three strikes,
and they are never letting you get out
they throw the book at you
like a caged animal
preying,
...as it lands on a page that says
a message from god
sins written on — listed off, and then
sent across the hall to your distant friend again

a life of recycling license plates
crime pays for the chip...

Read and leave comments (0)

U.S.AUSA4th of julypoetpoempoetrypoemsnaturemetaphysicsspiritualgodfireworks

Clothing Line

cut from a different cloth
dyed in the wool you pulled over your eyes

you made your bed now lie on it
tomorrow
is a wonderful day to die innit

I dress my wounds
and wear my heart on my sleeve
with cuff links & fingers crossed

Read and leave comments (0)

poempoetpoetrypoemsnaturemodelclothingfashiongodspiritualmetaphysics

Pandora's Box

Thought,

outside the realm of possibilities

Chaos …

beyond belief:

and great faith.

Read and leave comments (0)

greekgodspiritualmetaphysicsnaturegodpoempoetrypoetpoemsmythology

just walk away

pack your bags
and
go get ready

to walk the walk
through the traffic
of differing directions
wave down the runway
and remember…
never, look back

Read and leave comments (0)

modelingbeautyfashionnaturemodellovegodspiritualmetaphysicspoetpoempoems100 best poetry blogs

Divine Intervention

where did I put those car keys,
I think I have had one too many,
loss of memory —
and this
drug habit
has me... grabbing my head
trying to
get a grasp on my own sanity

Read and leave comments (0)

drugsalcoholsoberlovegodspiritualmetaphysicsnaturepoetpoetrypoempoems

questioning my destiny

In my study,
the test subject,
had to have
strands
of  this
genus’ genotype
“A” and be
exhibiting these abnormalities

Read and leave comments (0)

schoolNaturelovepoempoetrypoetmetaphysicsspiritualgodbeauty

The Lonely Willow

Willow’s over the river

A tear quietly drops

She is too tired to shiver,

I wasn’t born in a thicket.

 

No one is around here

No one to embrace…

Only the wind has found her.

Is she in such disgrace?

 

How hard it is for the willow

To stay here all alone,

Looking at the swallow,

Which all the trees know.

 

She has no one to talk with,

There is no one i...

Read and leave comments (2)

🌷(9)

naturelove

The Black Sea

Green

Green

Green

As far as the eye can see

Like,

Green

Green clouds

Hugging the earth

And me

 

Sea

Sea

Sea

Rugged dangerous

Enveloping me

 

The People

The People

The People

Safe and secure in their own skin

Unique in pleasure

Happiness overflowing into me  

 

Green Green

Sea Sea

The People The People

And me

Read and leave comments (0)

🌷(4)

BlackSeaTurkeytreeNaturesea

End of Summer

It’s said that one alone don’t make a Summer

but when there’s none at all, is that when Summer’s gone?

And when there’s nothing up there but a shimmer

of dust from the desert superheated by the sun;

and when the sheds and barns remain in silence

from April to October; when radiance that shone 

on midge-full fields no longer flicks on mindless 

scything wings and sideslippings ...

Read and leave comments (2)

🌷(4)

birdsswallowsNaturesummerthe end of summer

Poem: Summer..

The scorching heat of Sun,

children playing in ponds and having fun.

The temperature may rise,

and if you are enjoying it.

You are also wise.

That is Summer!

 

The feel of blowing wind,

And because of the sweat,

our bodies get thinned.

and my sister’s flying hair.

And if we go out too much,

our skin gets dark from fair.

That is Summer!

 

In deserts it i...

Read and leave comments (0)

🌷(8)

poempoetrysummerNaturelifeStudent

Auroral Resonance

Solar flares in tempest spent, Earth's veil angrily torn,
Charged plasma dances, skyward flight, in fury born.
Emerald and crimson,  a painter's dream, strokes the night,
Aurora's dance, magnetic wraiths, violet light
Transient beauty, fleeting flare for eyes to adore,
In silence held, earth meets sun's magnetic core.

Read and leave comments (0)

🌷(8)

Skynaturenorthern lightsengland

Project Astral

remote viewing
a program,
telepathic visionaries
— channels
seers…
seen in a screening
recorded and reviewed

Read and leave comments (0)

🌷(3)

lovepoetpoetrypoemnaturegodspiritualityspiritualmetaphysicsoccult

Ghost Writer

dispelling of a curse
wards off
unknown entities
who try their hand at automatic writing

ghosts, haunters, 
“en animant” in specters
instruments crescendoing
as the light abandons us

no ones home,
signs that say to go away

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualspiritualityoccultmetaphysics

Quantum Leap

displace - out
from this world
but,
not of it 

In finite spaces where mathematics add it, if
nothing changes places with one thing
And, then... again
this singularity is the black hole devouring our
multiplication - signs of the times
how the tables have turned
one number
spiraling out of control
Oh, flower of life...

Read and leave comments (0)

🌷(1)

poetpoemlovenaturespiritualoccultmetaphysicsgod

The Lakes

A trek I undertake 'neath summer's tender glow,
Where fells, by Wainwright sketched, beckon me to go.
Traversing paths of stone, now shattered and dispersed,
Each step unveils a vista, nature's grandeur unrehearsed.

Verdant hills cascade, a concert of green shades,
Rock of time's own hand, by icy sculptors made.
The fractures, deep and worn, map journeys tread before,
A lineage of travele...

Read and leave comments (0)

🌷(1)

Lake DistrictNature

Sweet Nothings

Queenship and Kingsman
The terms of endearment
scroll …
And, read through it

Except,
what’s in the fine print …

Maid of Honor …

If you would,
please …
As the left hand of the queen
swear your loyalty

Read and leave comments (0)

🌷(3)

poetpoetrypoemlovenaturespiritualspiritualitygodmetaphysicsoccult

Symbiosis of Broken Hearts

What is love?
Besides “A”
— a couple of
vowel sounds,
between U & I

ouïe?

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualitymetaphysicsmetaphysicaloccultspiritual

A Little Bird

He belted his little heart out

Same time every day

It lasted for hours and hours

But still…

She  does not come.

 

I shouted out to the little bird

“Why not perch on another tree?”

 

“I was calling out to you…”

the little bird replied,

“To keep that smile on your face.”

Read and leave comments (4)

blackbirdbirdsNatureour soul

Star seeds ‘n’ the Cosmic egg - of life

Dewy lotuses, 
grow in the dark -
creating an entangling —
Flower of Life …

nature and everything — we know — has its roots
on the grounds of truth
indeed…
every family tree,
needs...
a tree house.

Habitats for Humanity  

There is a lone wolf
which is black,
and blue,
in the eyes :
whom sees the world differently
depending on —
whether or not you’re 
— on his or her good or...

Read and leave comments (0)

🌷(3)

birthdayhappybirthdayoccultmetaphysicsspiritualmetaphysicalnaturelovepoempoetrypoetspiritualitygodtruth

april showers bring may flowers

I tried to wait,
But new flowers grow where the old ones die,
I didn’t want to move on,
But the sun involuntarily started to shine,
I lost myself searching for you,
But the fire eventually went out,
The dark smoke turned into wind,
I no longer needed to dwell on my feelings within,
New flowers grow where the old ones die,
Even if the soil needs to cry
Something beautiful can still arise

...

Read and leave comments (0)

🌷(3)

naturemoving on

Piñata Earth

Mother nature painted you by hand

Blue swirls traced along your land

A wonderous heaven lost to nature

May you still yet hopefully have a future?

 

You sway innocently in a dead void

Whille your cost of living is toiled

The aliens still infect you

Spewing out the innocence that held you

 

You are a blue green marble

A child's tale, a cherished fable

But waiting ...

Read and leave comments (2)

🌷(3)

earthglobal warminglifedeathNature

take the wheel

And venturing out
as an artisan model aircrafts
... enthusiast
is a larger than life recreation
to somebody
who
fell in love
with
Amelia Earhart's
figure 8

Read and leave comments (0)

naturelovevalentinesvalentinesdayspiritualspiritualitypoempoetrypoet

makeup sex

Ugh
Beauty standards ...
 
makeup your mind
you said you'd be ready
an hour past ...
you haven't changed at all
I'm leaving you
 
While i tease your hair,  suck it up
I'm head over heels in love

Read and leave comments (0)

beautymakeuplovenaturespiritualspiritualitypoempoetrypoetvalentinesvalentinesday

the Good Book

generational forefathers
bore thine
fruits of their labor,

to an heiress

Oh, the burden
given to this poor mistook child.

the Fall of man—after death
40 days and 40 nights,
If we were to predate the Gregorian calendar
… spring too,
life—before Christ—dark
and light archangels
would earn their halos
from Helios through
sun worship,
during the 7 Days of Creation,
summer was mad...

Read and leave comments (0)

🌷(3)

godspiritualspiritualitynaturelovevalentinesvalentinevalentinesdaypoempoetrypoetwriterart

Penguins, Popsicles and Polar Bears

Astronauts were packing it in.

​​​​​Wrapping up a long mission

when the ships sensors had a vision.
Beyond the hill of ice.
On a planet deemed to have no life.
A sign of life before them
beyond the hill were penguins.
Sliding down the peak
with Popsicles in their beaks.
A bundle over polar bears
sat watching in folding chairs
on the planet of Coldairus.

Read and leave comments (0)

🌷(4)

Rhymenaturespacefriendsastronauts

Time Travellers - 1775

Tread gently beneath the fragile fanlight

With its curving carved ribs

framing rippling glass

 

Glance up to the Venetian arch with its Canaletto morning sky

And the uncoiled mahogany staircase

Treads echoing to the creak and clatter of murmurous ghosts

 

Peel the plaster skin from the wall

Withies within, woven by dead fingers

Stiff reeds droop with the stilled pro...

Read and leave comments (2)

🌷(5)

historyNaturearchitecturegeorgiantime passes

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message