Donations are essential to keep Write Out Loud going    

Popular last 30 days

love poetry nature poem hope writer god beauty life poet

Popular last 12 months

love Poetry life poem nature poet War death loss pain

Poetry (Remove filter)

Recent Comments

: From A Fractured Time :

A moment in time did happen once.

                It was there and then it was no more!

Like a fickle wind that took a chance,

                To raise a head, but was gone before!

 

I would mull often in vacant times.

                If such a moment did occur awhile!

Or was it something without rhymes,

                As in the whimsies of a juvenile!

 

As ephemeral...

Read and leave comments (0)

🌷(4)

PoetryMusememoryabstractnostalgia

walk the line

My turn
I’m going to
spin the bottle
no one ever even noticed me
in High School
our first kiss
needs to be perfect
you don’t get a redo

Read and leave comments (0)

🌷(4)

bottlealcoholdrinkshighschoolpartylovepoetrypoetpoempoemswriterwritingoccultmetaphysicsmetaphysicalspiritualspiritualitygodnaturemodelfashionmakeupbeauty

love-hate relationship

obsession …
— envy us
in the way they stay upsetting
themselves.

you’re setting yourself up for failure

possible optimism

two glasses
my other, half
fully blurry vision
they’re prescription
usually she has to squint
and hadn’t felt the planets tilt till now

Read and leave comments (0)

🌷(1)

mediacouplefamousmodelfashionmakeupbeautylovepoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Red Dye Number 40

in pursuit of riches
snapped twigs, and
perseverance
exhausted —
all my resources …
gone,
in the heat of the moment.

Read and leave comments (1)

🌷(2)

moneybusinessmogulfashionmakeupmodelbeautylovepoetrypoetpoempoemswriterwritinggodnaturespiritualspiritualitymetaphysicsmetaphysicaloccult

Lost Angels

martyred
Tupac Amaru Shakur
Los Angeles

thug poetry

40 ounces of malt liquor
Olde English and calligraphy

slurring my words…
sounds as if I’m speaking in cursive

Read and leave comments (0)

losangelestupaccitystatecalifornialovepoetrypoetpoempoemswriterwritingspiritualspiritualitygodnaturemetaphysicsmetaphysicaloccultbeautyfashionmakeupmodel

Welcome

take your shoes off at the door

I’ll take your coat

your hair smells refreshened
from the ozone
and
remnants of soap
lathered and rinsed out
in the rain shower

Read and leave comments (0)

fashionmakeupmodelbeautyweddingmarriedcouplelovepoetrypoetpoempoemswritingwriternaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Rhetoric

attacking my integrity

questioning… me

myself,

I, was taught there was no such thing as a stupid question

second guessing…

why?

you were impolite.

looking for answers in an inner view

Read and leave comments (0)

🌷(1)

interviewquestionsanswertruthspiritualspiritualitygodmetaphysicsmetaphysicalnatureoccultlovepoetrypoempoetpoemswritingwritermakeupfashionmodelbeauty

Stars and Stripes

big brother
little kids,
children in the middle
of
civil war torn nations

warring

civil discourse

say your prayers

“Our Father”

we gather together to ask for salvation

Read and leave comments (0)

warcivilnationUSAarmylovepoetrypoempoetwritingpoemswriternaturespiritualspiritualitygodmetaphysicsmetaphysicaloccultbeautymakeupfashionmodel

High Performance

Spun -
A burnout —
driven to madness
and
crashing,
in a
drug fueled accident

What a catastrophe!

Read and leave comments (0)

depressedhappylovequotespoetrypoempoetwriterwritingpoemsgodspiritualnaturespiritualitymetaphysicsmetaphysicaloccultfashionmakeupmodelbeauty

Substance Abuse

You laid it down before me
Stuck the dollar in my nose
Got me breathing fast
Had me feeling trashed

One dose had me down
One hit and I begged for more
One more hit
One more kiss
One more line
One more night
Until my body went cold

Laced with poison
You decieved me
Lied about what you sold
And now I can't shake this crave
I can't shake this pain
I can't shake you from my brain

...

Read and leave comments (0)

🌷(4)

poetrytraumapast

verse on a hill

A known quantity bereft of quality;
a name of little beyond its letters,
by road’s shoulder perhaps guide

to openly weep a slippery slope
of once having known someone’s art
yet lay hold naught of their heart

eternally flowing river of kindnesses
shall meander, thoughts ever caress
even when words and faces now drift

a familiar feeling remains here still
years invested this regenera...

Read and leave comments (0)

🌷(6)

poetry

Star-Crossed Hearts

She was poetry, a dance in the air
Moving lightly, like a verse floating there
Hair in the wind, unpretentious lines
Her smile illuminated cloudy times
He, a simple man, lived raw prose each day
With calloused hands, unaware of the way
Life in bold letters, beauty lost in the grind
Chapters predictable, meaning hard to find
At the craft fair, a sun shining bright
He watched from afar, not...

Read and leave comments (0)

🌷(4)

poetrydancemanletterssunnamesstarslovelifeyoucoragesky

Infinitesimal

dimensional
cellular division
the genomic sequence

time is a light matrix
encoded in
0’s & 1’s
goes on forever …
and, in that order
10, 9.

A singularity
and absolute zero

the big freeze or heat death

he said no one can help us
when, asking the universe
for answers

what, times any number
… is nothing other than zero

Read and leave comments (0)

🌷(5)

mathmathematicsschoolpoetpoetrypoempoemswritingwriterusanaturelovefashionmakeupbeautyspiritualspiritualitymetaphysicsmetaphysicaloccultgod

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

🌷(1)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Family Ties

ancestors
shackled
and put in line
following the customs
of those, who
came before them
 

Read and leave comments (0)

natureUSAgodspiritualspiritualitymetaphysicslovepoetrypoetpoempoemswritingwriterbeautymakeupfashion

Moral Support

We shouldn’t be embarrassed
to talk
…. about our problems
to a therapist

always looking at me, before you speak

I’m here for —You
if ever
you feel the need to talk about anything.

Read and leave comments (0)

therapydepressionmentalhealthlovepoetrypoetpoemwriterwritingmetaphysicsoccultgodUSAfashionmakeupbeautynature

Trojan Horse

Generation X
plagued
with
this ease
that is,
going viral…

Read and leave comments (0)

sexlovebabyspiritualspiritualitymetaphysicsgodcreationpoetpoetrypoempoemswritingwriternaturefashionmakeupbeauty

Web of Lies

Paralyzed
like a spider
checking in on his victim
tied up, entangled …
makes me think
of a bad dream
worsened
the familiar feeling of
waking up to the news of death

Read and leave comments (0)

spiderbugsnaturegodspiritualspiritualitymetaphysicsoccultUSApoetpoetrypoempoemswriterwritingfashionmakeupbeauty

smooth...

They say he has his way with the ladies
the bruiser at the door
thought to himself
hey, let’s not get carried away

what a light weight ...
they had been seen leaving together
after a fight—being broken up
over a year at least

she said to all her girlfriends
“it was like I was blinking
then my eyes rolled back
into my head and everything went black”

Read and leave comments (0)

alcoholbardrinklovegodspiritualityspiritualmetaphysicsnaturepoetpoetrypoempoemswritingwriterfashionmakeupbeauty

Bible on a night stand

intermingling with a demon in the flesh
you realize your life was a lie
and your soul suffers in hell
for what feels like an eternal
date with death

Read and leave comments (0)

godspiritualitybiblespiritualmetaphysicsoccultnaturelovepoetpoetrypoempoemswriterwritingUSAfashionmakeupbeauty

Ebonics

A child
talking black
to their parents
acting out of character
arguing about upbringing
taken back
some things are best left unsaid…

Read and leave comments (0)

USAcrimeamericapoetrypoempoemspoetwriterwritinglovenaturegodspiritualspiritualitymetaphysicsmakeupbeautyfashion

Dark Side of the Moon

prophesied
the premonitions
foreshadow people
who live lives with
similarities parallel to our very own

when your third eye intakes light
and all the shades disappear in the night
their life is vibrant
the dream seen as an auric phenomenon
it’s either that
Or, are you completely isolated
in the back of the black of your eyelids

see an oracle or dream interpreter,
our aura’s rainbo...

Read and leave comments (0)

natureusagodspiritualitymetaphysicsspiritualpoetpoempoetrypoemswritingwriterlovemakeupfashionbeauty

Fog of War

smoking barrels
in talks —about the past
around the campfire

you could cut the tension with a knife

the only thing needed is a good sense of humor

And,
…try not to lose your self along the way

the buddy system
marching—
side by side
do you trust that man with your life?
willing to take a bullet for them?
behind every great man is a great woman…

Read and leave comments (0)

warusacrimearmylovepoetpoetrypoemwriterwritingnaturemetaphysicsspiritualitygodmakeupfashionbeauty

Sweating in my Sleep

This is a dream full of desires,
and I like to think
when we go to sleep eternally

our soul
will not be without
the rest in heaven.

Read and leave comments (0)

naturelovepoetrypoempoemspoetwritingwritergodspiritualspiritualitymetaphysicalmetaphysicsmakeupfashionbeauty

Which Tomorrow?

More poetic flash fiction based on the browsing of best selling book titles in under 30 words. Perhaps next time you're looking at a list you'll spot them all!

 

Tomorrow and Tomorrow 

And Tomorrow 

The Last Goodbye

Was the longest 

Then she was gone 

No one saw a thing 

Except for the couple 

At No 9

Read and leave comments (5)

🌷(8)

flashfictionpoetrystorytellingmystery

: The Barren Tree :

It grew in the wilds, a sentinel growing tall,

A mighty yogi in presence, embracing it all!

Branches reaching out, to the skies in a plea,

Seeking for the strength - to live it's destiny!

 

Its ancient bark, a wrinkled, weathered hide,

Tells a tale of the time's, swiftly flowing tide.

Inexorably which has grabbed, life in a churn,

On and onwards to - the lands of no return!

...

Read and leave comments (3)

🌷(7)

TreeMusesBarrenLifeNatureAncientPoetry

The Rich Want To Heal The World, But I Never Knew It Was Sick

You A Masterpiece 

On My Kurt Cobain Swagger 

Can I Ask You Please 

Will You Be My Courtney Love?

Read and leave comments (2)

🌷(1)

poetrypoemspoetlovelyrics

: Soliloquy :

A life had my thoughts, ephemeral and bright!

Coursing thru’ the skies, in a shimmering light.

                    And time reached out, in a glorious embrace;

                    Rushing me breathless, through empty space.

When the memories came, unbidden but true;

From the nether mind the feelings broke thru’.

                    Some moments to rejoice, some sharp agony.

  ...

Read and leave comments (0)

🌷(3)

PoetryMemoryMuseSonnetPastLifeThoughts

Dubbed Subtitles

what I say goes —
if I say so -
don’t allow an application to control anything
they need permission in these settings
and turn down your background music
“for what?”
if I’m going to green light your on screen time

we cannot have anyone getting an extreme close up
portray a picture perfect image

believe me...

flash forward,
when you’re using the front camera shutter you’ll see

y...

Read and leave comments (0)

🌷(4)

spiritualspiritualitygodmetaphysicsnaturelovepoetpoetrypoemfashionmakeupbeauty

I Accept My Reality

I accept

All the things around me

The harsh warmth of an Indian afternoon,

The confused colors of the evening,

Sheer darkness of night regardless of moon,

And everything between the end and beginning.

I have been trying to change my life,

But all I could change was my perspective.

I can’t seem to change the story, Though I attempt to shift the narrative.

I’ll fulfill m...

Read and leave comments (1)

🌷(4)

Poetrypositivityhopefulhealingself lovepatiencecaresimple

The Spectator

Spectator, from your ivory tower you peer,

Through sneers and smears, your wishes are revealed:

That poetry penned by plebs remain concealed,

Of Daffodils, irrational is your fear!

Uilleam Ó Ceallaigh 4th September 2024

Read and leave comments (2)

🌷(8)

daffodilspoetryplebs

: The Voices In My Mind :

All those voices yet in my mind,

From the years I had left behind.

            Casting echoes in that room -

            Pulsing through the dusty gloom.

The floating dust catching the light,

Shivered with unknown disquiet!

            The echoes gathered to surround.

            They animated the space around.

People I loved, now lost with time,

Speaking thru' the years...

Read and leave comments (0)

🌷(7)

Musememorythe pastpoetrysonnet

Pain Relief

When will it go away?

 

The pain in my chest

 

Pain in my stomach

 

Pain. 

 

It’s repetitive and never stops

 

It creeps up on me like bugs

 

Stings like a wasp

 

Bites like a mosquito

 

And leaves, taking a small part of me

 

Some say it’s a part of life 

 

Maybe I don’t want that

 

If this is life 

 

Maybe I don’t want any p...

Read and leave comments (2)

🌷(7)

painlovefriendshipreliefpain reliefhoperegretlossfaithpoetrypoem

Creature of Habit

at times I find myself
with insight
into my third eye
the inward perception
of crystalline tears
holding onto emotions
looking for one thing

The truth

Read and leave comments (0)

🌷(9)

naturedepressedsadlovepoetpoetrypoemgodspiritualspiritualitymetaphysicsmetaphysicalawakeningtruthbeautymakeup

Waxing Poetic

my love letter
stamped with a pair of pressed lips
licked,
then sealed with a kiss

the silent observer.
waiting for his moment
with the present

trying quietly not to mouth breathe aloud
smothered in your undergarments

while fire from the two flames
arose
on a magic candle
over and over

like a brazier come undone

Read and leave comments (0)

lingerieloveprettybeautyfashionpoempoetrypoetnaturegodspiritualspiritualitymetaphysicsmetaphysical

The Vacuum of Space

star dust -
quantum particles —

and, strings ...
from the fabric of the universe

ashes to ashes,
A bindi
black glasses,
fragmented obsidian
and, an asteroid belt

A Shero
— deified
hereafter she received
Saturn’s ring.

Read and leave comments (0)

spacecosmosastrologyspiritualspiritualitymetaphysicsmetaphysicalgodnaturelovepoempoetpoetrybeautyfashion

We Took a Wrong turn

You know what ?
they say,
three lefts make a right.

I’ll go ahead
and, uh…
double back around

now, where were we

we’re here

Where?

There.

well.. then,
why didn’t you just tell me that in the first place

Read and leave comments (0)

streetcartravelnaturelovepoempoetpoetrygodspiritualspiritualitymetaphysicsmetaphysical

Dead End

you need to
... stop
ignoring ...
the warning signs to
turn around your life

Read and leave comments (0)

carstreetlovepoempoetpoetrynaturegodspiritualspiritualitymetaphysicsmetaphysical

Bullet Points

This just in
The faulty firing pin — from a fire arm
had become dislodged
effectively,
causing it to misfire

very briefly …
in acceptance of all responsibility
the city-state committee
has sent a representative
that will be answering questions

now… back to you

in other news
we have a sunny forecast

there’s a color shader
right there, on
this heat map
that has an infrared si...

Read and leave comments (0)

gunsafetyfirearmsusalovepeacefreedomcrimemetaphysicsmetaphysicalspiritualspiritualitynaturegodpoempoetrypoet

Eyes on Me

I don’t want to be seen

 

I don’t want to be perceived

 

I wish I could go anywhere and be invisible.

 

People are everywhere

 

Eyes are everywhere

 

They’re all living their own lives but why do I feel as though mine is being watched?

 

As though they’re looking for a mistake in me

 

Is my hair messy?

 

Is my outfit mismatched?

 

Do I walk wei...

Read and leave comments (3)

poetrypoemlifeeyesanxietyhelpdepression

death of a gorgon

so I become this wrought iron
that I have forged with my own two hands.
I sharpen myself,
tip to hilt.
but
my mouth,
the very blade that can cut the sky,
chose to speak in a healers' tone instead.
I remind myself
of the violence it took
to become 
this gentle.
this cup of earth in my hands,
with home beneath
my fingernails.
I remind myself
what it means to be
pierced to the marrow
...

Read and leave comments (0)

🌷(2)

poetryrevelationinspirefeeljourneylove

: The Toss! :

The coin leapt up high above them.

And in it’s flight

The bright sunlight,

Made it glitter like a precious gem.

 

A lazy crawl to it’s apogee,

Then a shivering pause.

Which could be because,

The journey down has ‘gravity’!

 

Plummeting down from up so high,

It struck the loam.

Lost momentum

And opened a face to the sky.

 

The consequences are in the win...

Read and leave comments (0)

🌷(2)

PoetryTossAbstractinner thoughtscoin

AMBIGUITY

Ambiguity turns my wounds

into a stone punch.

And my chest is too old

to keep the painful sounds

within the beats

of my heart.

Ambiguity erodes my faith.

But in small acts of kindness

I somehow find a light of hope.

Sometimes I feel overwhelmed

with deep sadness

embedded deep down in my fate.

I still believe despite all the sadness

I believe that ambiguity w...

Read and leave comments (0)

🌷(4)

unknown feelingfeelingspoetry

what's that word again?

I've been in my feelings
and in my head for years.
I've built walls and
called them boundaries only
to wake up one day and realize
that I've boxed myself in

and that's the tragedy in it all;

in keeping myself safe
I've locked everything out.
and what a sad way to live,
peaceful and
picking my own muse 
to pieces until the only thing
left is
a bloody pile of 
everything I used to...

Read and leave comments (0)

🌷(5)

poetrysadlongingwritingdualityluggageshadow

on a thursday

i'm always the girl youre not sure about.
people have tried to make me
the girl you come back for.
but i want to be the girl
you never left.

and there are gaps in my happiness.
gaps in my teeth.
gaps in between breaths.
air, just...
slipping away.
fading away 
like colors on clothes
that have spent too much time
in the sun.

and what a funny way to say
theres always light in my l...

Read and leave comments (1)

🌷(6)

poetrylovesadthoughtful

If Galaxies Could Kiss

he never kissed me
goodbye.
there are no 
borrowed breaths 
bridging us,
no revival
on his lips.
just empty space
between memories
of when
there were no fireworks
and my feet
never leaving the ground.

Read and leave comments (0)

🌷(1)

poetrysepiaobscuresorrowdisappointment

A Universe Of Poetry

Merseyside poets have launched a free online anthology entitled 'A Universe Of Poetry'. The work is available to view on the Facebook platform, and will be part of a live upcoming event at the famous Bidston Observatory Artistic Research Centre on the Wirral Peninsula on August 15th this year.

Editors Barry Woods and Michelle Wright specifically curated the project for the observatory, with a t...

Read and leave comments (0)

BarryWoodsSpacePoetryUniverseMichelleWrightBidstonObservatory

Spaceminded

I’ve drifted in space,

In endless, boundless darkness, 

Escaping the allure of evil. 

Where sound fades away, 

yet voices still whisper, 

Silent screams echoing in the cold solitude,

Invisible to all, no matter how present I am, 

Like a symphony played in reverse or a piece of art unnoticed, 

Where time seems to crawl in slow motion,

Adrift in a single, unchanging direct...

Read and leave comments (2)

🌷(5)

mental health awarenesspoetry

Rust

I'm afraid I'll lose my edge
if I don't cut myself with it

afraid there's no proof
of my life
if it isn't pouring crimson

afraid that 
I'm living in vain if
I'm not
living in vein

Im afraid I'll lose my edge
if I don't cut myself with it

Read and leave comments (1)

🌷(8)

existentialpoetrybleedwriting

Show more entries …

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message