Donations are essential to keep Write Out Loud going    

Popular last 30 days

love Nature God life Hope poetry poem war writing depression

Popular last 12 months

love poetry Life Nature poem war pain hope poet loss

poetry (Remove filter)

DAYS OF OLD

Why am I so unfortunate?

You ever wonder that?

Because I do, and wonder

Why am I always begging at the hands of others?

You know, those who strive to thrive unlike me,

Because I, I stare at walls.

 

I wonder,

Why does the wind change direction in my world?

It’ll blow north, south, east and even west,

All directions but mine,

Why does it never blow in my face?

Wh...

Read and leave comments (1)

🌷(7)

poetry

Labelled

Becoming slowly unrecognizable to yourself and others
Feelings and thoughts take
a hold, giving you the shudders
Memories and emotions that seem to flood your heart
Faces and places making it hard to know where to start
Decisions throughout the day, waiting to be made
Resting again in bed where it all just seems to fade
Urges of wanting help yet not knowing what to say
Triggers causing you...

Read and leave comments (1)

🌷(6)

poempoetrywritingmentalillnessmentalhealthrhymerhyming

Valentines

Taking time out on a couple of dates for one
May seem lonely or anti social for some
But having space to yourself - mostly all alone
Shows a few changes that you have outgrown
Valentines Day - being a special one for lovers
A time of anticipation and kindness for others
Loving yourself by being your own best friend
A journey in itself which doesn't need to end
A card, message or present yo...

Read and leave comments (0)

poempoetryromanceromanticvalentinesdayvalentineswriting

Valentines Day

Dressing up, styling hair, feeling fine
Card and presents, wait to be opened, all in a line
Roses, chocolates and bottles of red wine
Celebrating Valentines Day, its just a matter of time
Happiness shown, whether it be rain or shine
Cupid wasn't so stupid, sending his arrow as a sign
The restaurant booked, we drink and then we dine
Thinking that when we met, he must of made you mine
More s...

Read and leave comments (0)

poemspoemwritingvalentinesdayvalentinesromanticpoetry

New Years 2023

As the year of 2023 comes to a relieving close
We think over the good and bad times we chose
Memories stack up again and then begin to fade
Thinking up New Years Resolutions to be made
We begin to look to the joys of a fresh New Year
Where we start to wave a huge good-bye to fear
Tears and worries that consumed part of 2023
Are left behind as the New Year brings a new me
With the help of R...

Read and leave comments (0)

poemspoetrywritingrhymenewyearsnewyear2023

Spring

There's something about this season, Spring
Waking up to birds as they, sing
Trees and its blossom show subtle, pinks
Clouds and rain, for thr earth now drinks
The sun reappears, having such a glow
As if it were trying to say, hello
I go to the garden to walk around
To see what other things are found
Butterflies with their colorful wings
How this season holds such beautiful, things.

Read and leave comments (0)

poempoetrywritingspringrhymerhyming

Lockdown

Going to bed then waking up late, what lies ahead?
We ask you fate
Jogs in the winter sun around the area,
Becoming healthy - losing weight
With hope in the vaccine and wanting to be immune
We look to this date
Remembering things of the past, finding comfort
Talking to a mate
Thinking what we have done and future plans
Good and bad times we know await.
 

Read and leave comments (0)

poetrypoemwritingrhymelockdowncovid19

Separation

No matter how much the shouting, its the inside worth counting
Never mind harsh words of a person, their actions could never worsen
Others with a listening ear, may take away the fear
The unknown goes on behind closed doors, hiding all the flaws
Love seemed a while away, yet so did the other day
Fondness comes after the trouble, back to how things were, a couple
Smiles are exchanged, somehow...

Read and leave comments (0)

poempoetrywritingliferelationshipsrelationshipsending

Misfortune

Letting someone else's light shine brighter than mine, isn't such a prideful crime,
I should listen to what people have to say, to have the attitude of 'come what may',
Speaking my mind being always kind, the truth is what I then, shall find,
I think, I think, I think too much, I would rather not about such and such,
I learned to appreciate from a distance, family and friends, I love within an...

Read and leave comments (0)

🌷(1)

poemwritingrhymepoetryreal life

Written in Stone

an epitaph
covered in overgrown grass
numbers and a letter encrypted,
written to the deceased,
for only those who knew him
you’d truly understand

Read and leave comments (0)

🌷(4)

familyfriendsdeathlovegodspiritualspiritualitynaturemetaphysicsmetaphysicaloccultpoetpoetrypoempoemswriterwriting

Hot Spring

the plumes of a caldera,
and the dark clouds,
sun overshadowed,
at its core a scalding heat turned colder
because of similarities
shared this simile
for the changing of seasons, anew
an unforgiven embrace

Read and leave comments (0)

beachsummerseasonspoetpoetrypoempoemswriterwritinglovenaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Table Manners

he wouldn’t let us leave
without paying,
for our meal

had to-go

then bantered with them
and, you ordered to make him take it back

the whole ordeal was a real headache,
I could feel tension in the temple,
and had to meditate, to
clear my head and relieve the stress

I wanted to post a pic of my meal,
but it was almost traumatic

Maybe, I’m just being over dramatic?

Read and leave comments (0)

dinnermakeuplovepoetpoetrypoempoemswriterwritingnaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultart

size them up

had me my hand me downs
and, we all know too well known
if the shoe fits wear it

nicest stuff is worn out and she wore my XXL shirt around the house
her chores, get done…
one bra in the wash and no panties on

The first steps
commemorated with expensive shoes,
soles being broken in,
a mash of burning glass,
molten sand and in it,
it’s silica content

Read and leave comments (0)

🌷(7)

cinderellaglassartworkartpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovemakeupfashionmodel

approach with caution

veered off, routine stop, in the shoulder…
looking over your paper work,
keep your hands on the steering wheel,
“I’m not going to ask again”
repeated offenses
respect my authority

police officers
a ford mustang and dodge charger

government funded electric vehicles
take a look inside the hood, it
purrs like a street cat with a scratchy throat

cut the lights on and off
I’m just try...

Read and leave comments (0)

USApolicecarpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovecreativeartartwork

phishing

attempts
online attachments
“Hooks & Worm” viruses
hosted— a parasite

on the web
spider crabs
In their net

Read and leave comments (0)

funfriendsbeachsummerpoetpoetrypoempoemswriterwritinglovequotesquotenaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultinternetviral

: From A Fractured Time :

A moment in time did happen once.

                It was there and then it was no more!

Like a fickle wind that took a chance,

                To raise a head, but was gone before!

 

I would mull often in vacant times.

                If such a moment did occur awhile!

Or was it something without rhymes,

                As in the whimsies of a juvenile!

 

As ephemeral...

Read and leave comments (0)

🌷(5)

PoetryMusememoryabstractnostalgia

walk the line

My turn
I’m going to
spin the bottle
no one ever even noticed me
in High School
our first kiss
needs to be perfect
you don’t get a redo

Read and leave comments (0)

🌷(6)

bottlealcoholdrinkshighschoolpartylovepoetrypoetpoempoemswriterwritingoccultmetaphysicsmetaphysicalspiritualspiritualitygodnaturemodelfashionmakeupbeauty

love-hate relationship

obsession …
— envy us
in the way they stay upsetting
themselves.

you’re setting yourself up for failure

possible optimism

two glasses
my other, half
fully blurry vision
they’re prescription
usually she has to squint
and hadn’t felt the planets tilt till now

Read and leave comments (0)

🌷(1)

mediacouplefamousmodelfashionmakeupbeautylovepoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Red Dye Number 40

in pursuit of riches
snapped twigs, and
perseverance
exhausted —
all my resources …
gone,
in the heat of the moment.

Read and leave comments (1)

🌷(2)

moneybusinessmogulfashionmakeupmodelbeautylovepoetrypoetpoempoemswriterwritinggodnaturespiritualspiritualitymetaphysicsmetaphysicaloccult

Lost Angels

martyred
Tupac Amaru Shakur
Los Angeles

thug poetry

40 ounces of malt liquor
Olde English and calligraphy

slurring my words…
sounds as if I’m speaking in cursive

Read and leave comments (0)

losangelestupaccitystatecalifornialovepoetrypoetpoempoemswriterwritingspiritualspiritualitygodnaturemetaphysicsmetaphysicaloccultbeautyfashionmakeupmodel

Welcome

take your shoes off at the door

I’ll take your coat

your hair smells refreshened
from the ozone
and
remnants of soap
lathered and rinsed out
in the rain shower

Read and leave comments (0)

fashionmakeupmodelbeautyweddingmarriedcouplelovepoetrypoetpoempoemswritingwriternaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Rhetoric

attacking my integrity

questioning… me

myself,

I, was taught there was no such thing as a stupid question

second guessing…

why?

you were impolite.

looking for answers in an inner view

Read and leave comments (0)

🌷(1)

interviewquestionsanswertruthspiritualspiritualitygodmetaphysicsmetaphysicalnatureoccultlovepoetrypoempoetpoemswritingwritermakeupfashionmodelbeauty

Stars and Stripes

big brother
little kids,
children in the middle
of
civil war torn nations

warring

civil discourse

say your prayers

“Our Father”

we gather together to ask for salvation

Read and leave comments (0)

warcivilnationUSAarmylovepoetrypoempoetwritingpoemswriternaturespiritualspiritualitygodmetaphysicsmetaphysicaloccultbeautymakeupfashionmodel

High Performance

Spun -
A burnout —
driven to madness
and
crashing,
in a
drug fueled accident

What a catastrophe!

Read and leave comments (0)

depressedhappylovequotespoetrypoempoetwriterwritingpoemsgodspiritualnaturespiritualitymetaphysicsmetaphysicaloccultfashionmakeupmodelbeauty

Substance Abuse

You laid it down before me
Stuck the dollar in my nose
Got me breathing fast
Had me feeling trashed

One dose had me down
One hit and I begged for more
One more hit
One more kiss
One more line
One more night
Until my body went cold

Laced with poison
You decieved me
Lied about what you sold
And now I can't shake this crave
I can't shake this pain
I can't shake you from my brain

...

Read and leave comments (0)

🌷(4)

poetrytraumapast

verse on a hill

A known quantity bereft of quality;
a name of little beyond its letters,
by road’s shoulder perhaps guide

to openly weep a slippery slope
of once having known someone’s art
yet lay hold naught of their heart

eternally flowing river of kindnesses
shall meander, thoughts ever caress
even when words and faces now drift

a familiar feeling remains here still
years invested this regenera...

Read and leave comments (0)

🌷(6)

poetry

Star-Crossed Hearts

She was poetry, a dance in the air
Moving lightly, like a verse floating there
Hair in the wind, unpretentious lines
Her smile illuminated cloudy times
He, a simple man, lived raw prose each day
With calloused hands, unaware of the way
Life in bold letters, beauty lost in the grind
Chapters predictable, meaning hard to find
At the craft fair, a sun shining bright
He watched from afar, not...

Read and leave comments (0)

🌷(4)

poetrydancemanletterssunnamesstarslovelifeyoucoragesky

Infinitesimal

dimensional
cellular division
the genomic sequence

time is a light matrix
encoded in
0’s & 1’s
goes on forever …
and, in that order
10, 9.

A singularity
and absolute zero

the big freeze or heat death

he said no one can help us
when, asking the universe
for answers

what, times any number
… is nothing other than zero

Read and leave comments (0)

🌷(5)

mathmathematicsschoolpoetpoetrypoempoemswritingwriterusanaturelovefashionmakeupbeautyspiritualspiritualitymetaphysicsmetaphysicaloccultgod

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

🌷(1)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Family Ties

ancestors
shackled
and put in line
following the customs
of those, who
came before them
 

Read and leave comments (0)

natureUSAgodspiritualspiritualitymetaphysicslovepoetrypoetpoempoemswritingwriterbeautymakeupfashion

Moral Support

We shouldn’t be embarrassed
to talk
…. about our problems
to a therapist

always looking at me, before you speak

I’m here for —You
if ever
you feel the need to talk about anything.

Read and leave comments (0)

therapydepressionmentalhealthlovepoetrypoetpoemwriterwritingmetaphysicsoccultgodUSAfashionmakeupbeautynature

Trojan Horse

Generation X
plagued
with
this ease
that is,
going viral…

Read and leave comments (0)

sexlovebabyspiritualspiritualitymetaphysicsgodcreationpoetpoetrypoempoemswritingwriternaturefashionmakeupbeauty

Web of Lies

Paralyzed
like a spider
checking in on his victim
tied up, entangled …
makes me think
of a bad dream
worsened
the familiar feeling of
waking up to the news of death

Read and leave comments (0)

spiderbugsnaturegodspiritualspiritualitymetaphysicsoccultUSApoetpoetrypoempoemswriterwritingfashionmakeupbeauty

smooth...

They say he has his way with the ladies
the bruiser at the door
thought to himself
hey, let’s not get carried away

what a light weight ...
they had been seen leaving together
after a fight—being broken up
over a year at least

she said to all her girlfriends
“it was like I was blinking
then my eyes rolled back
into my head and everything went black”

Read and leave comments (0)

alcoholbardrinklovegodspiritualityspiritualmetaphysicsnaturepoetpoetrypoempoemswritingwriterfashionmakeupbeauty

Bible on a night stand

intermingling with a demon in the flesh
you realize your life was a lie
and your soul suffers in hell
for what feels like an eternal
date with death

Read and leave comments (0)

godspiritualitybiblespiritualmetaphysicsoccultnaturelovepoetpoetrypoempoemswriterwritingUSAfashionmakeupbeauty

Ebonics

A child
talking black
to their parents
acting out of character
arguing about upbringing
taken back
some things are best left unsaid…

Read and leave comments (0)

USAcrimeamericapoetrypoempoemspoetwriterwritinglovenaturegodspiritualspiritualitymetaphysicsmakeupbeautyfashion

Dark Side of the Moon

prophesied
the premonitions
foreshadow people
who live lives with
similarities parallel to our very own

when your third eye intakes light
and all the shades disappear in the night
their life is vibrant
the dream seen as an auric phenomenon
it’s either that
Or, are you completely isolated
in the back of the black of your eyelids

see an oracle or dream interpreter,
our aura’s rainbo...

Read and leave comments (0)

natureusagodspiritualitymetaphysicsspiritualpoetpoempoetrypoemswritingwriterlovemakeupfashionbeauty

Fog of War

smoking barrels
in talks —about the past
around the campfire

you could cut the tension with a knife

the only thing needed is a good sense of humor

And,
…try not to lose your self along the way

the buddy system
marching—
side by side
do you trust that man with your life?
willing to take a bullet for them?
behind every great man is a great woman…

Read and leave comments (0)

warusacrimearmylovepoetpoetrypoemwriterwritingnaturemetaphysicsspiritualitygodmakeupfashionbeauty

Sweating in my Sleep

This is a dream full of desires,
and I like to think
when we go to sleep eternally

our soul
will not be without
the rest in heaven.

Read and leave comments (0)

naturelovepoetrypoempoemspoetwritingwritergodspiritualspiritualitymetaphysicalmetaphysicsmakeupfashionbeauty

Which Tomorrow?

More poetic flash fiction based on the browsing of best selling book titles in under 30 words. Perhaps next time you're looking at a list you'll spot them all!

 

Tomorrow and Tomorrow 

And Tomorrow 

The Last Goodbye

Was the longest 

Then she was gone 

No one saw a thing 

Except for the couple 

At No 9

Read and leave comments (5)

🌷(8)

flashfictionpoetrystorytellingmystery

: The Barren Tree :

It grew in the wilds, a sentinel growing tall,

A mighty yogi in presence, embracing it all!

Branches reaching out, to the skies in a plea,

Seeking for the strength - to live it's destiny!

 

Its ancient bark, a wrinkled, weathered hide,

Tells a tale of the time's, swiftly flowing tide.

Inexorably which has grabbed, life in a churn,

On and onwards to - the lands of no return!

...

Read and leave comments (3)

🌷(7)

TreeMusesBarrenLifeNatureAncientPoetry

The Rich Want To Heal The World, But I Never Knew It Was Sick

You A Masterpiece 

On My Kurt Cobain Swagger 

Can I Ask You Please 

Will You Be My Courtney Love?

Read and leave comments (2)

🌷(1)

poetrypoemspoetlovelyrics

: Soliloquy :

A life had my thoughts, ephemeral and bright!

Coursing thru’ the skies, in a shimmering light.

                    And time reached out, in a glorious embrace;

                    Rushing me breathless, through empty space.

When the memories came, unbidden but true;

From the nether mind the feelings broke thru’.

                    Some moments to rejoice, some sharp agony.

  ...

Read and leave comments (0)

🌷(3)

PoetryMemoryMuseSonnetPastLifeThoughts

Dubbed Subtitles

what I say goes —
if I say so -
don’t allow an application to control anything
they need permission in these settings
and turn down your background music
“for what?”
if I’m going to green light your on screen time

we cannot have anyone getting an extreme close up
portray a picture perfect image

believe me...

flash forward,
when you’re using the front camera shutter you’ll see

y...

Read and leave comments (0)

🌷(4)

spiritualspiritualitygodmetaphysicsnaturelovepoetpoetrypoemfashionmakeupbeauty

I Accept My Reality

I accept

All the things around me

The harsh warmth of an Indian afternoon,

The confused colors of the evening,

Sheer darkness of night regardless of moon,

And everything between the end and beginning.

I have been trying to change my life,

But all I could change was my perspective.

I can’t seem to change the story, Though I attempt to shift the narrative.

I’ll fulfill m...

Read and leave comments (1)

🌷(4)

Poetrypositivityhopefulhealingself lovepatiencecaresimple

The Spectator

Spectator, from your ivory tower you peer,

Through sneers and smears, your wishes are revealed:

That poetry penned by plebs remain concealed,

Of Daffodils, irrational is your fear!

Uilleam Ó Ceallaigh 4th September 2024

Read and leave comments (2)

🌷(8)

daffodilspoetryplebs

: The Voices In My Mind :

All those voices yet in my mind,

From the years I had left behind.

            Casting echoes in that room -

            Pulsing through the dusty gloom.

The floating dust catching the light,

Shivered with unknown disquiet!

            The echoes gathered to surround.

            They animated the space around.

People I loved, now lost with time,

Speaking thru' the years...

Read and leave comments (0)

🌷(7)

Musememorythe pastpoetrysonnet

Pain Relief

When will it go away?

 

The pain in my chest

 

Pain in my stomach

 

Pain. 

 

It’s repetitive and never stops

 

It creeps up on me like bugs

 

Stings like a wasp

 

Bites like a mosquito

 

And leaves, taking a small part of me

 

Some say it’s a part of life 

 

Maybe I don’t want that

 

If this is life 

 

Maybe I don’t want any p...

Read and leave comments (2)

🌷(7)

painlovefriendshipreliefpain reliefhoperegretlossfaithpoetrypoem

Creature of Habit

at times I find myself
with insight
into my third eye
the inward perception
of crystalline tears
holding onto emotions
looking for one thing

The truth

Read and leave comments (0)

🌷(9)

naturedepressedsadlovepoetpoetrypoemgodspiritualspiritualitymetaphysicsmetaphysicalawakeningtruthbeautymakeup

Show more entries …

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message