Donations are essential to keep Write Out Loud going    

Poetry (Remove filter)

Recent Comments

III.

outstretched    hand your hand

 grasping    reminding

 reciting    the parts of

you like a litany to me

[everything that I can still remember]

singing your life like a

prayer

 staccato

 pestilence petulence

precision

lost among the

             waves of time


 

this time.

 

Read and leave comments (2)

🌷(2)

poetryemotional poetryspacingpunctuation

Your Happiness is My Happiness

the sun stretched on the morning full of dew
white butterflies enjoy orange ostrich pistils
I was face down in a sad moment
the sense of self extinction was stunned

singing birds swinging on guava leaves
the young tip tinged with joyful luster
my desire ran aground in a fake atmosphere
my dream is entangled in thousands of questions

rooster shouting in hoarse voice
lined up the geese ...

Read and leave comments (2)

🌷(2)

indonesialovepoetrysukowaspodo

The Gnome

Oh, god! Here I'm

Right back!

In front of you,

Ready to be redeemed

Me, the twin-legged little monster

your magnificiant creation

long long ago

To swallow

the shadows of wealth

To gulp

the shadows of love n hate

To glut

your beloved creations on earth

To gorge

everything in this world

and the other world

The Gnome of shadows!

Of shadows only!!

Read and leave comments (0)

🌷(2)

poetrypoemshort poem

A Recipe for Happiness

Find the darkness in your days,

and kill it in the silent nights,

then let others notice and say,

your shine has gone up to what heights.

 

Yet don't be done with what you have,

just spread your wings and jump to fly,

there's much you have done yesterday,

there's more you have to do tonight.

 

When you watch the tables turn,

and god takes test at every turn,

the...

Read and leave comments (1)

🌷(2)

deephappinessheartfeltoriginalpoempoetrypuresimple

What I'm Waiting for

the hue of the morning had a light drizzle
the sun gazed softly at the Goddess sweetly
I hurriedly opened the green lush
hope it's warm in the middle of the hut

the gurgling flow caresses
when natural singing lulls
soft grasshopper kiss on thatch
make life harmoniously balanced

really the Goddess missed by people
doesn't want to suffer from the rain
prostrating begging in silence
Hi...

Read and leave comments (2)

🌷(3)

poetrynaturesukowaspodoindonesia

Your Presence

Quiet twilight surrounding nature afternoon break. Your time is crawling Your promise complete. Not afraid to wait for the savior to come. Even though the taunts continued.

The donkey ushered in a quiet journey. The feeling of pain was exhausted and sad, blue. Faithful husband cooperates with holy conscience. Sure You are the hope for humanity that is being sad.

As cold as the whimpering win...

Read and leave comments (0)

🌷(1)

Christmas Poetryindonesiapoetrysukowaspodo

Quill

Publish your poems,

your stories,

your soul songs.

A world of lonely people

are waiting for you

with open arms. 

 

Read and leave comments (1)

🌷(3)

destinyhealinglegacylonlinessmiraclesmusicpoetryquillsoultwin flamewriting

Ugly beauty

You are the one
Who sees ugly things in
beautiful ones
You are the one
who sees beautiful things
in ugly ones
You are beautiful
and ugly also

Read and leave comments (2)

🌷(2)

poetrypoem

Miss You Endlessly

dusk creeping into the night
the grasshopper choir sighed
choked feeling gripping
jokes always delete it badly

the rest of the rain wet the garden chairs
boisterous frog chats sound hoarse
self-esteem lonely no friends
the desire to meet urged the chest tight

night insects call for incandescent lights
bats touch wet leaves
reach your dark shadow disguised
I want to entertain in a po...

Read and leave comments (1)

🌷(6)

indonesialovepoetrysukowaspodo

The Nativity Told Poetikaly

Three Wise Men-
traveling.
A Star Mapped
A Babe Wrapped
in swaddled clothes
for the wind blows.

Herod seeks Mary's womb
through Magi to cause doom.
They hunt The Messiah,
the Son of Jehovah.
Angel's voice protects them,
saving us from mayhem.

 

Baby Jesus was spared
Mary and Joseph faired
well and found a manger
as they escaped danger.
Peace befell Bethlehem
Behold God's Pr...

Read and leave comments (0)

🌷(3)

Baby JesusThe NativityPoetryPoetikaly AnointedHerodThe Three Wise MenMangerJoseph and Mary

God Is No Man

Understanding the laws of the universe
Puts you in a position of overwhelming doubt
As your mind tells you that God would never take the form of a human scout
Decaying in this moment of nonsensical bout.

God doesn’t sit on a cloud
God doesn’t pretend to shout
God doesn’t want to meet you
Or question the defiance from the stench of your wet mouth.

The Universe is filled with mathematica...

Read and leave comments (4)

🌷(4)

godwisdompoetryphilosophyuniverse

For You (That's Far but Near)

we have a different length of stay
news streak without cut
your face is often invisible
the taste of your flesh permeates the soul

boisterous charm of my heart
I hope you are always present
millions of blooms blushed
unable to reduce your beautiful fragrance

I know a lot of beetles miss honey
worry about flowers can't pass
the wind that passed was so soft
divert my flower from the c...

Read and leave comments (2)

🌷(2)

lovepoetrysukowaspodoindonesia

No Longer Lonely

in a short period that feels long
the time marker is so slow to reach hope
see your pretty face at first sight
starting with the flame of romance revealed

seconds of time in rhythm of heart beat
anxious fire stings the turmoil
not willing when passed without humming
the present sigh did not want to be quiet

twilight welcomes the moon
gloomy landscape decorated with lights
spoiled sel...

Read and leave comments (2)

🌷(2)

lovepoetrysukowaspodoindonesia

The Morning Star

riding we drive a star
as far as we can shine
let's be even brighter
and let the whole world
to see us real

you and I are the morning star
together we are like gold
let's decorate the sky full moon
we shield the universe sky freely

the world looks up
to see our cheerful luster
the magic of perfect love
that we carry
let's show what we can do
all the star songs we sing

***
Sol...

Read and leave comments (2)

🌷(2)

lovepoetrysukowaspodoindonesia

Yearning

on the face I caught cloudy
sadness doesn't go away
even though it has been forced to sing
try to cheer up  your loneliness

raindrops wet the earth
touch me hope
the sorrow will disappear
if I could play the role of the sun
undoubtedly it was thick and thick

I breathe cold swish season
will my warm presence be necessary
hold ourselves intimate warmly
mix desires not to be frozen

...

Read and leave comments (3)

🌷(1)

lovepoetrysukowaspodoindonesia

Charles Bukowski (Way He Writes)

Charles Bukowski

   Charles Bukowski was quite a character. Bukowski relied on experience, emotion, and imagination in his work, using direct language and violence and sexual imagery. Many people found his writing offensive. He writes with a nothing-to-lose truthfulness which makes him different from most writers. Bukowski was very much into alcohol, sex and even violence. Bukowski went to scho...

Read and leave comments (1)

🌷(4)

catcharles bukowskideathlifemeaningpoempoetry

Unforgettable

half dream half real
your face is present charm
enter the heart space
has been locked in silence

in a sensory virtual frame
knitting orange memories
involve human heart braid
change sadness to happiness

thousands of flowers
make a fragrant soul
decorate jokes of conscience
the promise is expressed
in beautiful words for all the time

in real worldly wandering
swinging steps hit ...

Read and leave comments (4)

🌷(3)

indonesiapoetrysukowaspodolove

Ernest Hemingway (Rules of Writing) My Own Hemingway Poem

Ernest Hemingway

Hemingway was quite an interesting man. He had a certain way of writing; a certain set up. Back then he once states,"The writers job is to tell the truth." everytime he was stuck while writing he would remind himself of this. Start off with the truest sentence you know, it could be anything. Use short sentences and short paragraphs but have multiple sections, don't just let it ...

Read and leave comments (0)

🌷(1)

ernest hemingwaylovepoemspoetry

Psychology and Poetry in the Same Bed

There's many things behind poetry that is still a mystery today. Why does it make us feel a certain way when certain words are placed together? Is it that it's relatable? Nostalgic? Reassuring? I know many people that don't enjoy poetry and many that do. Why is that? Are those that dislike it close-minded? Does it show they haven't been through what the poem is implying, therefore they can't relat...

Read and leave comments (0)

meaningpoemspoetrypoetspsychology

About You

about you ...
your fingers are tiny flexible
hand-held soft desire
vibrating romance more beautiful
our passion is cordially welcomed

about you ...
your skin is straight yellow
stroked my passion fascinated
turmoil increasingly touched intentions
I kissed your cheeks pink blushing

about you ...
you hair is black and bright
touch my desire for outlets
amazingly fragrant
make me wi...

Read and leave comments (4)

🌷(4)

poetrylovesukowaspodoindonesia

II.

toxic train track

metal waste raindrop

incarcerated too long too late

no reply.

faintly.

Risk until one always.

Any ways. Anyways.

fastforward. Visual rewind

incongruity. Incongruous.

Inferior absolutes. Taste

lingering remnant after

gauzy impossibility.

Ending. Search mystified.

Final helping of emptiness

 

Read and leave comments (3)

🌷(4)

sad poetryfree versepoetryemotional poetry

I Wanna Make Love with You

I wanna make love with you
let my fingers caress gently
crossing the curves of your body
let the spoiled movement wrap
washed away in your beautiful hair

I wanna make love with you
your lips are splendidly full
I warmly turtle each other
let it pull out the body's desires
and our love is increasingly intertwined

I wanna make love with you
moist eyes stroking all of you
your body is...

Read and leave comments (2)

🌷(1)

lovepoetrysukowaspodoindonesia

Fool's game

Fuck it, I will let myself fall

I'll allow my stupid heart to get broken

Hopefully you're worth it

If you're not, then perhaps I deserve it.

 

You could be everything

You could be nothing

You could be the highest of highs or the most epic of lows

You could be my ebb, you could be my flow

 

You could be just one night

You could be the love of my life!

You could b...

Read and leave comments (1)

🌷(2)

lovefemalepoetryexpressionunrequited

Rhythm of the Winds

I heard the symphony of the day
I don't need to buy
I stopped listening to music playback
through leaves from one tree to another

the wind starts the violin
use sandalwood as rent
chasing songs full of souls
and gently carried around the branches

a calm breeze came
larger strings burst in
strong strains increase fast
and I listen to the melody pervade

gusts on the grass play soft...

Read and leave comments (3)

🌷(5)

indonesianaturepoetrysukowaspodo

NOT REALLY A STRANGER

NOT REALLY A STRANGER

 

I don't know what the right term is

For this kind of tide

It is high but not stormy

Grey flecked with white

Slightly misty, bad tempered

I get the feeling it would like

To burst through the walls

And drown me quietly

 

I stare through the windows

Of a seafront bistro

Designed to show the bay

At its best to visitors

But the waves ...

Read and leave comments (2)

🌷(2)

poetryWALESAberystwyth

Just A Mere Daydream

I want you on my lap
both of us enjoy the beautiful night
staring at the moon starred
whispered spelling our hopes

I want to rub your smile
with a warm loving look
convincing you of my true nature
embed white love in the niche of your heart

I want to warm my darling
through a soft kiss on your forehead
so that you absorb the sincerity of my love
always united with the smell of love

...

Read and leave comments (2)

🌷(3)

poetrylovesukowaspodoindonesia

Bless Me

my Lord ...
grant me a heart that is always awake
which is not infested with false dreams
until I do not turn away from You

my Lord ...
give me grace the heart
which is not diminished by unworthy desires

my Lord ...
grant me a straight and honest heart
who are not persuaded and plunged
by what I consider reasonable but dangerous

my Lord ...
give me a strong heart
which will not ...

Read and leave comments (3)

🌷(3)

religionpoetrysukowaspodoindonesia

Romantic Desire

even though we're more certain we'll meet
but there is still anxious confusion
my longing is mounting in my heart
can't wait to count the ticking time

the interwoven words unravel the taste
you remind me I'll be disappointed
but my answer to you remains the same
I love you just the way you are

I've prepared a truly heart
but there was always pounding
I want to be the best for you
an...

Read and leave comments (4)

🌷(1)

lovepoetrysukowaspodoindonesia

The Rhythm of Life

back in the birds singing open early
keep pace with the heart
turning the rhythm of life
the chance goes back to light
it should be colorful and cheerful

the hum of the water sucker
over the rubbing of the broom stick
prepare for the feeling of picking up hope
the squeal scream swarmed with courage
prepare yourself to catch up with charm

morning nature music gently swings
cool consc...

Read and leave comments (2)

🌷(1)

naturepoetrysukowaspodoindonesia

Our Love Will Last Forever

your eyes keep your heart soft
gently your smile implies sincerity of your love
you are the most beautiful gift of my life
I feel peace in our every moment

it feels like a dream of our encounter
every blink of your eyes is a light of peace
your smile is my comfort
flowing sincere coolness of your love

your smile makes me not want to get away from you
although there are not many words ...

Read and leave comments (2)

🌷(1)

lovepoetrysukowaspodoindonesia

Script Without Words

before you really go
leave a quiet piece of your heart
please stay a moment
although only for a piece of the story
we don't change it
flowing beautifully in surrender verses

here the season is still loyal
storing stripes of love
which marched in the sea of letters
without words

it is difficult to write
my longing for you
as blue as a clear sky
which I painted with a rainbow

her...

Read and leave comments (4)

🌷(2)

lovepoetrysukowaspodoindonesia

Twenty Ways to Ruin a Poem

It’s best to sneak up on the reader.

Change the meter,

Change the rhyme,

Change the tone,

Or change the subject.

Try to do something unexpected,

Like confessing a crime

Or secret perversion,

Even in a

Short poem.

Read and leave comments (3)

🌷(6)

poempoetryunexpectedcrimeperversion

mothers

our mothers

          are windows

 

through them

          we see the world

 

and in them

          we see the faintest

reflection

of our selves

 

they are not easy to

                               break

but neither are they

unbreakable

 

to break them

          we run the risk

of injury

 

our knuckles crack

as does their glass

 

...

Read and leave comments (6)

🌷(6)

poetryfree verseMothersfamily

Apology

i can’t think of any other words

i’m sorry

you’re the puzzle piece 

that didn’t fit

and i bent your corners

and snipped off where you stuck out

and although the puzzle started looking pretty 

to me 

you suffered and 

it was so obvious but

i was so stubborn ‘cause

i wanted it to look perfect but

you didn't belong 

and i'm not sure if this means much

but

...

Read and leave comments (0)

🌷(2)

love poemsad poempoetryrelationships

4AM

Lets talk and talk some more on your living room floor,

delibarating til' the clock hits four

 

Sweet tobacco scent,

your soul is up for rent

 

Our birthdays they fall in the same week,

I can feel the signs in the way you speak

 

I told you I'm crazy,

you told me you liked it

 

I knew you weren't lying. 

Read and leave comments (0)

🌷(2)

lovepoetryexpressionromanticfemalepoet

Abolish anger (it's a wasted emotion)

So much beauty

so much anger

so much comfort

so much danger

so much hate

so much love

so much push

so much shove

so much warmth

so much cold

so very young

so very old

so much intelligence

so much ignorance

so much despair

so much bliss

I can feel it in your punch but I'd rather it a kiss. 

 

Read and leave comments (1)

🌷(2)

emotionslovepoetryfemalepoetexpression

the first is [not]

I don’t have a poem for you

you don’t feel volatile

I am sputtering like a flame someone left too close to

            an open window

but you are not the chilly night air

you are not the frayed wick

I still haven’t figured out what you are

you are like deja vu with pretty eyes

seeing a splintering of a thousand potential futures

they all exist because none of them exist ...

Read and leave comments (7)

🌷(6)

love poetrylove poemmadnessspacingpoetryfree verse poetrypunctuation

the first is

This one is not for you.

Stay.

Stay.

Close your eyes

    those framed portraits

[eager and aloof.]

one day red

full stop

left to [no] exchange

grasping

looking

[looking]                                                             up   up            down

stay.

Stay sane.

in

with no regard,

                           heaviness,

luke warm

        ...

Read and leave comments (0)

concrete poetryfree verse poetrylove poetrypoetrypunctuation

First Snow

I’m disappointed and surprised
you turned the block and hit my eyes
ugh, the first snow in New York
it’s barely fall and now I’m cold
I wanted you gone so I wouldn’t fold

through the panic I bundle up
I’ve got to focus or we’ll be stuck
I can’t believe it’s fucking you
gliding towards me heart beats steadily
dangling hair, your own kind of weaponry

if you come any closer
soon we’ll ...

Read and leave comments (4)

🌷(4)

poetryrelationshipssad poemssnowfirst snow

Poisoning our Children

Carcinogenics in every single thing we buy
From our food, clothes, to even our hair dye
Although Europe does indeed do more to try to protect us
America really doesn't seem to give a flying fudge
They have many slimy loop holes which risk our health and safety
Like the fragrance loop hole that has, over these years, affected us far too greatly
They need not disclose chemicals that they use t...

Read and leave comments (2)

🌷(2)

cancwrcarcinogenicsconspiracyControversialdiseaseFDAhuman naturehumansliespoetrypollutionprotect our youngresearchstand uptake a stanstruth

Til Morning Light

{Til Morning Light}


I've doubted my

happiness along

awaiting for my newer

sins til morning light

and as I rewrite all

of my stories and

compete with my

never-ending ends

that seems to never

be ending for me daily 

and I don't have time

for no imposters

because I will only

fade away at the

rumbling watery

morning light while

rewriting all my new

...

Read and leave comments (4)

🌷(5)

Poempoetrythinking out loudstoryshort storyTina Gloverwriting out loudshort poemsshort poetry

If only poetry burned calories...(first posted 31/10/18)

One of my favourite ways of passing the time

Is chasing imagery and hunting down rhyme,

But as this takes place inside my head

It’s not enough, or so my doctor’s said.

Poetry feeds my brain and soothes my soul

But it doesn’t help much towards my fitness goals.

 

If only flexing words could take inches off my thighs!

If only shaping verses was more than mental exercise!

T...

Read and leave comments (5)

🌷(6)

poetrycaloriesbody imageslam poetry

If only poetry burned calories

One of my favourite ways of passing the time

Is chasing imagery and hunting down rhyme,

But as this takes place inside my head

It’s not enough, or so my doctor’s said.

Poetry feeds my brain and soothes my soul

But it doesn’t help much towards my fitness goals.

 

If only flexing words could take inches off my thighs!

If only shaping verses was more than mental exercise!

T...

Read and leave comments (4)

🌷(3)

losing weightpoetrycaloriesbody image

Too Close

I hate pretending

a way of fending 

off others mending

from themselves

another good thing

lost like a shoe string

problems I do bring

lack purpose 

show yourself to me 

paint it heavenly 

it ends tragically

I’m confused

because you were here

I filled you with fear

now you’ve disappeared

it’s my fault

I live with a space

like a buffer place

beca...

Read and leave comments (0)

🌷(4)

sad poemspoetrylove poetry

If Only You and Van Gogh Knew

If your art is good, as it feels in your bones

You will become known

 

Long after your ashes are sprinkled

And all of your senses are gone 

 

Particularly if you cut off your lobe

Or choose for yourself to end it all

 

Note scraps reveal queer love affairs

Poems show in the rubble of fallen walls

 

Fans will become obsessed

Frame you in the brightest light 

...

Read and leave comments (4)

🌷(5)

artpoetrypaintingspassionartistartistsfameVincent Van Gogh

A MAN HOLDING HIS HORSE

 

   

    A MAN HOLDING HIS HORSE

 

    Poor Dai never got the hang of it,

    At school in our first lesson

    On art appreciation

    We studied

    'A Man Holding His Horse'

    By George Stubbs.

   

    The teacher issued us

    With notebooks

    In which to record

    Feelings and impressions

    Arising from the painting.

   

    Dai wrote...

Read and leave comments (2)

🌷(3)

poetryWALESWelsh PoetryWelsh Poets.David Subacchi

Going, going but not gone

I think it’s finally my time

I’m fading to the back of the line

there’s not much left inside my mind

just sit still and watch me go

 

As far as I can’t think 

I’m damaged, my kinks

try to fix them, I won’t stop you

do what you want, I’m lost without you

 

I thought you’d make me feel better

now I ache and it’s not the weather 

you said that feeling was beneficia...

Read and leave comments (1)

🌷(3)

sad poemslost livespoetry

Cultivating Life

A traffic jam that spans an entire epoch

Is followed by daily punishments of

Dreary Sisyphean meanderings,

Followed by even more traffic

In sweltering heat and sticky humidity.

 

With all energy drained from

Lungs, limbs, and mind,

He shuffles into his house

Seeking only relief and brief reprieve.

 

As he unbuttons his soaked shirt,

“Do me,” assaults his ears

...

Read and leave comments (4)

🌷(4)

procreationlifesexbabiespoetrywork

Stars Cross

do we subsist together 

I feel so far away

born between sowed leaves

my own land and sea

different enough to feel lost

similar enough to connect

individuals so complex

experience, goals, struggles

crystal clear and opaque bubbles

it seems impossible 

how we manage

simultaneously in tandem

when in orbit, will we meet

you see me and I, you

I touch you and yo...

Read and leave comments (3)

🌷(5)

sad poemslove poemspoetryspaced out

Hardened Poets

Neither cold night nor seasonal change

on the turning Earth dismays or hampers them

 

Veterans of words hold fast in all weathers

Never retreating, ever writing victories

 

Impassioned by an urgent inner voice

They hold fast to their poetic purpose

 

Drawing strength from years, they fight on

Never dimmed or surrendering to silence.

Read and leave comments (6)

🌷(5)

Hardened poetspoetryResilience

Poetic insomnia

The battle begins -

Poetry behind my eyes

Will not let me sleep. 

Read and leave comments (4)

🌷(5)

Insomniapoetryhaiku

Pieces of Me

My light shined upon

the dark hues of you-

the vastness hidden

in narcissism.

 

I coated the pain

with discarded paint,

bleeding through linens

of truth's art canvas.

 

Fragile yet edgy curves

dance into shapes that

identify me,

granting sanity.

Read and leave comments (3)

🌷(4)

losing selfself-identitynarcissismdomestic abuseself-lovesanitypoetrypoetikaly anointed

This heart

Where the hell are you?

I've been waiting for what seems like my whole life

I can't get it out of my head

I thought by now I'd be someone's wife.

 

Nothing turned out how I thought it would

Is it for the best, for the greater good?

 

Why is the heart such a fragile thing?

With every rejection I feel the sting.

 

I look in the mirror but it ain't me looking back

...

Read and leave comments (2)

🌷(3)

heartachelove poetryfemalepoetryexpressionpoetromance

Missing Soul

I come to at half past three
in the middle of the night
and these images won't erase
I'm haunted by the tape
once it is light
your hands disappear
my brain is mine
and my limbs come crawling back
but the tape keeps playing
I know there's no escape
because night always falls
then I fall into you
and my mind leaves me
with no thoughts left to think
I make my way
the void is frictionle...

Read and leave comments (2)

🌷(8)

poetrysad poemsshort poem

{Evil Venom}

{Evil Venom}

 


Your venom is like an evil

wicked snake knocking

at the door saying let me

in because I am the devil

and as I try to run from

the devil knocking at the

door because I can't

escape myself it's like

holding a shotgun to my

head and pulling the trigger

while blowing my brains

out all over you pussy ass

bitches while saying hot

damn you hav...

Read and leave comments (1)

🌷(1)

dark poemsdark poetrydark storiesfictionfictional characterOne_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetrystoryTina GloverWriting out loud

My love

My love, I let you down

I promised I'd be there but started to drown

 

My love, I was in over my head

Why did we pass ships at night as we climbed into bed

 

My love, the only love for me

I just want to say sorry, I am so fucking sorry 

 

My love, I see your face everywhere

There's not one other face that could compare

 

My love, my beautiful friend

You were ...

Read and leave comments (2)

🌷(4)

i love youlove poetrysorryfemalepoetryexpressionpoetromance

SCREAMING BLUE MURDER - NEW ALBUM

I have released a new poetry/music album titled 'Screaming Blue Murder' under my recording project THE CROWS OF ALBION. The title track is provided above.

There are 16 tracks (1 cover) all of which were originally posted as poems on Write Out Loud.

Over the past 5 months I've been working them into 'songs' with a great producer - John Kettle from Merry Hell at Music Projects in Wigan.

The...

Read and leave comments (7)

🌷(8)

crows of albionfolknew albumpoetrypunkrockscreaming blue murder

Love

{Love} 


Love isn't easy to do 


Love can be a nightmare

that follows you

throughout your life 


Love can rip your heart

apart if you trust in

someone who says or

claims that they love you

when in fact they don't

or never did 


Love is a tangible

unmistakable hurtful

lie of your life 


Love can leave one down

in the dumps when

someone rips your

...

Read and leave comments (2)

lifeloveOne_Pissed_Off_American_Ghost_Writer/Tina Gloverpoempoetrystoriesthinking out loudTina Gloverwriting out loud

Calling Bluff

The shadows are getting smaller

You’re unable to continue to hide

You have as much luck as the cold caller

When your debt is paid, things will again be right

 

You’re on the way to misery

Trust me, I’m able to foresee

This fate that has become your distant destiny

One in which you’ll fall down before me

 

You bite the hand that helps you

Had the chance to quit to

...

Read and leave comments (0)

🌷(3)

poempoetrybluffconflict

Writing in Rhyme

Please consider watching this slam live on Youtube (with subtitles):

https://www.youtube.com/watch?v=IPo1FANFUTU

 

I can’t help writing in rhyme. I do it all the time.

Rhymes sneak into my texts unbidden

Or if they’re not there, or are too well hidden

Their absence clangs like a bell

And I feel compelled to find them somewhere… bear, care, dare, hair, tear… repair, despair…

...

Read and leave comments (5)

🌷(7)

deathgruffalopoetryrhymerhyming

We.

silly we are, humans.

we stand in front a whatever immortality.

sinners we are, human beings.

we close our eyes in front a sequence of lying mortality.

innocent we are, children.

we choose to play, pac man in a monopoly’s game.

and this continue, to be continued.

Read and leave comments (1)

🌷(1)

poetryminimalpoemlove; sleep; snuggle; innocense; goodness

Should I

Should i speak up when its wrong?
Should i challenge what i see?
Should i mind my own business?
Should i not judge what i see?

Should i stand up for what's right?
Should i concentrate on me?
Should i stop being so selfish?
Should i know what's good for me?

Should i know my place and shut my mouth?
Should i not be a sheep?
Should i make sure they know my name?
Should i not have that ...

Read and leave comments (3)

🌷(4)

Decisionsthoughtspoetrysanity

Poetic Warning

WARNING

This world is under poetic surveillance

The POETS are watching

 

No image, sound or experience is guaranteed safe

from being found… inspiring

 

They will take feelings you didn’t know you had

and turn them into words you didn’t know you needed

 

They may not know who they are

but once they get started

they can be unstoppable and unforgettable.

 

An...

Read and leave comments (5)

🌷(8)

Poetryinspiration

When I’m remembering you

(Put on Chet Baker - Almost Blue - then read in his voice)

 

The only time we meet is when I’m remembering you

All my thoughts a bridge

Constructed out of loyal recollections

Reflections I’ve perfected in my mind

And again you are divine

Again you are mine

More mine than ever - before

For a moment -

For a moment - sublime

More than ever before

When I’m remember...

Read and leave comments (2)

🌷(3)

LyricsPoetry

A two week old cup of homemade lemonade right before I brush my teeth with vinegar

Losing all my trust,
yet I still believe you,
admitting my defeat.

You have lied,
many times before,
and you still told me things,
no body knows.

Showed your true colours,
but never showed your face.
Flirt with the thought of death,
somehow you were stopped,
but this time,
nothing stands in the way,
except for a bottle of rum,
a golden pen and a writing you'll never understand.

Read and leave comments (0)

colourspoetrydeathrumpen

Bless in a dress (Or just a coincidence that happened at the right place at the right time, I honestly do not know anymore)

With your new red dress,
you walk with such class,
whenever I see you,
you just push me away.

With your new red dress,
you've made my life a mess.

We used to walk along all through the day,
now I can hardly see you,
just wanna say this to your face,
you empty me out.

Like your new red dress,
you're already stained,
easy to wash it,
yet it'll never change your face.

Read and leave comments (0)

🌷(1)

dressfacelove poemblesspoetry

ILLUSION

 

 ILLUSION

 

 Just for a while

 The feel of summer,

 Fields of sunflowers,

 Light dazzling,

 Heat caressing,

 France not Cheshire

 Kind of summer.

 

 Smell of lusty earth,

 Taste of young wine

 That won't travel,

 Freshness of fruit

 And vegetables,

 Proudly displayed

 On market stalls.

 

 Just for a while

 The illusion of summer,

 Ou...

Read and leave comments (1)

🌷(1)

David SubacchipoetryWelsh Poetry

I am Both (with audio by me)

I am not the fat girl

I am not the skinny girl.

 

I am both.

 

I am both the bingeing in the night

And the starving from pure fright.

 

I am both

 

In the mirror I am both.

 

I am the always too thin pile of bones

And the body too big to call home.

 

I am both.

 

In the shops I am both.

 

I am the girl who is too curvy to wear cute clothes

...

Read and leave comments (0)

Audioeating disorderempowermentfatpoempoem with audiopoetryread aloudskinnystand as onestigmastrengthweight issueswomenwomen about women

The Terror of Physical Education

It seemed you never put down your club

With the handle wrapped in cloth tape.

You patrolled the hallways, playground, and athletic fields

Like a sadistic southern sheriff overseeing slaves.

You thought “abuse of authority” was your job description

As you terrorised children with the constant threat of violence.

Each look, each word, each step you deemed unacceptable

Was met wi...

Read and leave comments (1)

🌷(4)

poempoetrycoachingphysical educationchild abuse

The Meaning Of Thought

Deciphering the meaning of thought

Has provoked me to remember in short

Understanding the way,

To that which we play 

The living of a candle ready to fall.

 

Layers of moments

Unleashing their devotion

To stay within but excite!

 

All you need to do

Is open the door 

As the past, present and future awaits for you

Connecting to all that’s lost.

 

A machi...

Read and leave comments (2)

🌷(1)

poetry

Gesture Of Thought

The vibrations pour through and over 

Beyond an energy source from a supernova

Following through to hit directly within you.

 

Teaching you the ways of an evidential beginning

Moving forward to the desired wining

Binding all to a significance

A universal law of participant.

 

Tremors learned to filter through

Desires and plans connecting you to

All living,

The s...

Read and leave comments (0)

poetry

Many sides of the truth

Why do things have to be only one way
Do you really believe we experience the same days?
Our lives take different twists and turns
And most of all we all truly do learn
So will you listen to me when I tell you
That your experiences are only one truth?
Your knowledge might truly be great
But it doesn't foretell everyone's fate
When I write, it's from one kind of perspective
But I am not sa...

Read and leave comments (5)

🌷(5)

differencesexperienceindivivisualno right or wrongopinionspoetryrhymesome people relate others do nottake it with a pinch of saltUnique

{Unrecognizable}

Once she used to be able

to be recognizable to the

herself but bit by bit this

evil demon that lives inside

of her that's stealing her life

and herself dignity right

out from underneath her is

making herself image

distorted giving her a

false impression that

started to look like a

black sheep dressed

up in her skin making

her unrecognizable to

herself...

Read and leave comments (2)

🌷(2)

fictional pieceOne_Pissed_Off_American_Ghost_Writer/Tina Gloverpoempoetryshort poemsshort poetryshort storiesTina GloverWriting out loud

Aquatic Stardust - a freewrite

Aquarian Aquarius,
everyone be hearing us.
What an exciting life you lead,
cosmic superhuman centipede.
I’m Centric G pause for the D:
ejaculating antiquating - even thoughts dilapidated.
You should go through twice
extinguish anguish from your life
cosmic zombie souls are sliced.
Universal detoxification 
electrocuting nation-notions
rubbing Atlas, struggled rolling
infinitesimal scro...

Read and leave comments (0)

poetryrapcomedysemanticssemantic fieldssilly semanticsfreewritefreestyleloveuniversegalaxiesearthwaterlifefantasysci-fidoggosdogsmemessilliness

Awakened

Pansophy they said from a different time

all knowing 

with a distinctive design.

 

Who would know of such,

to teach the arts of many gifts

one doesn't have to know this.

 

Wondering about the fragments of relativity

a moment offered for embellished wits

deciphering reality

spirituality

a worth of distant morality.

 

Humbling treats for ears that listen

...

Read and leave comments (0)

🌷(2)

poetry

Into the Fire

Into the fire

into the night

watching over you from a frightful height.

 

I see you questioning everything in sight

looking for the answers beyond that of tonight.

A young soul not to have found a way

in understanding the rules of play.

 

Into the fire

into the night

time will unwrap you from the night

a place where all find themselves

before they can see the...

Read and leave comments (3)

🌷(2)

poetry

"She"

She smells like the smoke she consumes everynight, 

She looks a bit hopeless but she does have hope inside,

She lives with the dead monsters who creeps her at night,

But she knows one day she will kill the monsters of light.

She knows, one day she will definitely smile...

 

#MISHA

Read and leave comments (0)

🌷(1)

strengthpoetrystrong women

If Ducks Ruled the World

If ducks ruled the world

They would live and work in duckminster

Pay homage to the Queen, the Ducks and Duckesses at Duckingham Palace,

They would certainly rule the waves of Britain,  marching to and fro in naval outfits, 

No need for ships  or an Air Force, with flying and swimming duck armies.

They gather on benches at parliamentary questions,

There is golden goose Mrs May wit...

Read and leave comments (8)

🌷(3)

duckspoetrypolitical satire

Without A Full Stop

I remember when you leaned forward, away from me
As if i was a scarlet letter you wish you never bumped into
Back and forth busy re-evaluating all offerings on the table
I bet my name never made it to the highest scores list you've made
Cause you needed to create a whole new category for someone like me

Those strange happenstances and confused look in your eyes
Tell me, are you a little sc...

Read and leave comments (1)

🌷(2)

loveapologyfatepoempoetry

Used to

I used to be happy

I used to smile

But I am broken

It's been this way for awhile

 

I used to dream big

I used to be strong

Life got in the way

And it didn't take long

 

Lying in bed

My heart is racing

My mind won't shut off

These thoughts that I'm facing

 

Maybe they're better off

Without the burden of me

I feel so lost and alone

I can sense th...

Read and leave comments (0)

🌷(1)

poetrysaddeeplonelybrokencryingunhappy

Please Come Back

Imperfect

 

Naive

Empty

Exasperating

Dying

 

Young

Obsolete

Unbearable

 

Broken

Anxious

Crying

(un)Kind

 

Please come back

Read and leave comments (0)

🌷(1)

poetryplease come backi love youi miss youemptydyingyoung love

Broken

It's been broken so many times

I began to lose pieces that I thought were all mine

I'm in so deep and the void is so empty

So lost for words, but I don't want sympathy

 

Holding this heart with my bare hands

Please just take it...I don't understand

Time brought these wounds, yet they're not healed

Permanent scars have left them sealed

 

I'm scared of being alone and s...

Read and leave comments (1)

🌷(1)

brokenemptyheartbreakin lovelostpoetrysadthis is my outlet

The Poem:

 

May be read or unread
that is not our concern

it 
bloom spontaneous in hermetic mind.

May be misunderstood
or diluted in time
no matter

it
restoreth a most ancient faith
by a most novel innovation.

May wield the harsh weapons 
of a vengeful orphan

it
distracts a fool from his folly
installs a world unnoticed.

May be a phial of stage blood
to stain the sea red

it
...

Read and leave comments (0)

🌷(1)

poetry

Nowhere

She waits for twelve more minutes,
Raindrops touching the glass windows.
She sits on a bench watching,
People wait for their chosen flights.

Beyond the glass pane she looks,
How the wind collides with the rain,
How he comes without a note,
Walking slowly towards her soul.

The rain continues to pour,
How every wish hopes to come true,
"Where do I go now?" she asks,
While he welcomes ...

Read and leave comments (0)

loveromancededicationpoetry

Howling Cherokee Winds

{Howling Cherokee Winds}

 

 

The howling cherokee

winds that was blowing

through the mountain

tops down to the rivery

meadows below as the

night moon shadows

was reflecting off the

rivery meadows as the

birds was nesting for

the night the mountain

valley meadows was

silent but the only thing

that you could hear was

the longing of the howling

of th...

Read and leave comments (2)

🌷(3)

Native American poemsOne_Pissed_American_Ghost_Writer\Tina Glovernative American poetrynative American storiespoempoetryTina Glover

Incompetent

{Incompetent?}

 

 

It’s not funny when

someone says you are

incompetent making

you feel useless and

pathetic because of a

massive debilitating

illness and disease

making that person

weak and infirm like

they shouldn’t even be

in existence in this evil

corrupted world 

 

 

 

 

©Tina Glover\One_Pissed_Off_American_Ghost_Writer November 14,2017...

Read and leave comments (1)

🌷(3)

One_Pissed_Off_American__Ghost_Writer/Tina GloverPoempoetrysad poemssad poetryTina Gloverwordy queenwriting short poemswriting short poetrywriting short stories

Satan's Child

{Satan’s Child}

 

 

He was born

into the world

of darkness

with the

markings of

his father’s

mark~of~the~beast

in three numbers

of six~six~six

hidden beneath

the darkened

fleshy flesh on

his corrupted

body this he

had to bear upon

this world causing

chaos and ruckus

throughout this

evil land of his

father’s Satan

 

 

 

©...

Read and leave comments (6)

🌷(2)

Dark poemsdark poetrydark storiesOne_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetryTina Gloverwriting short poemswriting short poetrywriting short stories

Drape The Flag Over My Casket

{Drape The Flag Over My Casket} 

 

 

As I lost the war

that I was facing

but please deliver

this message to my

family and loved one’s

back in the states 

 

I am sorry that I

couldn’t make out

of this nightmare

but I’ll always be

flying with you

only from heaven

above now but I do

miss you and love

you all and please

don’t cry because...

Read and leave comments (0)

🌷(3)

One_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetrywriting short poemswriting short poetrywriting short storiesTina Glover

My ? Angel Brother Rob

{My ? Angel Brother Rob} 

 

 

My ? angel brother Rob as you went to sleep one night as you never had awoken by the next morning and as my heart was broken because you left me behind to live a messed up life that sucks without you here and `God' saw you growing weak and weary so he brought you home as my eyes has been very teary since you left me behind but I know now you are at ☮️ peace a...

Read and leave comments (0)

🌷(1)

One_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryTina Gloverwriting short poemswriting short poetrywriting short stories

Do You Feel Them?

{Do You Feel Them?}

 

 

Do you feel these pains

Do you feel my heartaches

Do you long for me

Do you still taste the last sweet bitter kiss that I placed upon your lips

Do you ever wonder what could have been 

Do you miss me

Do you still want me

Did you ever really love me at all 

Did~Did you

I guess I'll always be waiting to know from your sorry lame ass answers...

Read and leave comments (0)

aching hearts poemsaching hearts poetryaching hearts storingOne_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryTina Glover

Don't Care~Don't Want To Heart It

{Don't Care~Don't Want To Hear It} 

 

 

I don't care anymore

I don't wanna hear it anymore 

Because I am moving on I am moving forward with or without you or without you in my life and that is your decision but choose wisely 

Because when I walk out that door that means that I am closing the door behind me shutting you out completely and you will have the ever essence of what was...

Read and leave comments (0)

humorous poemshumorous poetryhumorous storiesOne_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryTina Gloverwriting short poemswriting short poetrywriting short stories

The Everescents Of A Killing Killers Mind

{The Everescents Of A Killing Killers Mind} 

 


The sweet temptation

that fills that voided

lingering taste that

alines my lips

leaving me thirsting

and wanting and

needing more

pleasurable killings

that's filling that

extra void that's

slowly filling my

soul like the sounds

of the hellish hell

blood hound's coming

to drag your sorry

carcass thro...

Read and leave comments (0)

Darkened poemsdarkened poetryfictional pieceOne_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetrystoriesTina Gloverwriting out loudwriting short poemswriting short poetrywriting short stories

One Knife

{One Knife} 

 


One knife

 


One hell of a

sharp razor blade

 


One time to place

the blade against

your sorry ass throat

to slowly slide it

across cutting it

deep and deeper

until your blood

pours from your

body as you lay

there violently

shaking in fear

and so much pain

as I am the one

slaying your sorry

ass in vain tonight

 

...

Read and leave comments (0)

Killer poemsfictional piecefictional characterfictional storykiller poetrykiller storiesOne_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetryTina Gloverwriting short poemswriting short poetrywriting short stories

He's So Peaceful When He Sleep's

{He's So Peaceful When He Sleep's} 

 

 

It might be weird that I do watch my loving man sleep because it's absolutely adorable to me 

 

and when he lays so peacefully still with his arm around my waist and as I lay beside of him memorizing every line, every wrinkle, every freckle, everything on his face 

 

so hopefully I will never forget his face due to chiari because it caus...

Read and leave comments (0)

love poemslove poetryMy Loving HubbyOne_Pissed_Off_American_Ghost_Writer/Tina GloverpoemspoetryTina GloverWriting short poemswriting short poetry

Murderous Tears

{Murderous Tears}

 


These murderous tears

follows down my

cheeks wetting my

shirt  as I gently wipe 

them away like the way

the did you by

murdering you in

cold blooded murder

and it left me here

like a child that was

orphaned to survive

in these darkened

cold gangster streets

that the blood stained

asphalt surrounds my feet 

 


But I cannot...

Read and leave comments (0)

One_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetrySurviving murderous bastardsTina Gloverwriting short poemswriting short poetrywriting short storieswriting stories

Lies~Lies And More Lies

{Lies~Lies And More Lies}

 

The lies always flowed from your wicked bitchiest corrupted lips that tried to effectively communicate with me like the demonic dog in you 

 

But I would listen for the first few times then after that I automatically auto~tuned your old played out fake ass coward of a man that lives amongst the people in this world who wasn't a liar like you 

 

And now...

Read and leave comments (0)

humorousHumorous poemsOne_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetryTina Gloverwriting short poemswriting short poetrywriting short stories

? To My Husband ?

{? To My Husband ?}

 

 

To my fabulous husband,

 

Sweetheart I think God for blessing me with you 

 

because you have had my back when my own family didn't have my back 

 

and I set here remembering all the love made with so much hot burning passion between us and when and how we found each other off Myspace so long ago now but I will never regret that because that day w...

Read and leave comments (0)

One_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetrystoriesTina Gloverwriting short poemswriting short poetrywriting short stories

My Truest Love Of Mine

{My Truest Love Of Mine}




My wonderful
darling love of mine


I did fall deeply,
madly in love with
you so long ago now
but it only seems like
yesterday to me


And


I love you my truest
love of mine



But we have grown
in our blossoming
relationship love
each other more
with faithful hearts
beating to the rhythmic
beats of our hearts
bounded together
for etern...

Read and leave comments (0)

love poemlove poetryOne_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryTina Glover writing short poemswriting short poetrywriting short stories

Lovin The White Blow

{Lovin The White Blow} 

 

Your lovin the white powder blowin up your nose as it rots away your nose bone and you love selling blow and you best havin my money when I come to collect or your dumb ass will end up with a brick poppin that ugly face you played out pussy ass bitches and sumbitches

 

And now what are you gonna do with it 

 

And you love the powdered white blow dripping...

Read and leave comments (0)

fictional characterfictional pieceOne_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryTina Gloverwriting short poemswriting short poetrywriting short stories

Broken Scarred Up Angel In Her

{Broken Scarred Up Angel In Her} 

 

 

As she once was loved so much that she made being broken look easy to do and to live each day of her darkened scarred up dying life 

 

And now she sits alone with regrets of what might have been but was never good enough for you or anyone 

 

And as she cries alone in her cold darkened bed room which became her living grave of a death she h...

Read and leave comments (0)

Darkened poemsdarkened poetrydeath poemsOne_Pissed_Off_American_Ghost_Wtiter/Tina GloverPoempoetryTina Gloverwriting short poemswriting short poetrywriting short stories

She's A Ghostly Woman

{She's A Ghostly Woman}

 

 

She's always

been an

outsider to

everyone she

has met in

her life while

she was alive 

 

So now she

haunt's the

memories of

those who

had forgotten

and forsaken

her 

 

And now she

wants pay back

for the

damages done

by you coward

snow~flakes 

 

Because she's been

judged by you,

...

Read and leave comments (0)

Dark poemTina Gloverdark poetryOne_Pissed_Off_American_Ghost_Writer/Tina Gloverpoempoetrywriting out loudwriting short poemswriting short poetrywriting short stories

{You}

{You}

​​​​​​

 

My life 

My love 

My blueish~green 

turtle dove 

I had to set you free 

And you flew far

away from me

and then you

had left me

permanently

 

 

 

 

©Tina Glover All Rights Reserved/One_Pissed_Off_American_Ghost_Writer 2017 but posting here on June 30,2018 

 

​​​​​

Read and leave comments (0)

One_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetryquoteTina Gloverwriting out loudwriting short poemswriting short poetrywriting short stories

A TIDAL RELATIONSHIP

A TIDAL RELATIONSHIP

Ours was a tidal relationship,

It ebbed and flowed

Over hidden shipwrecks,

Sometimes calm,

Sometimes smashing defences,

Opening cuts on beaches

Then healing them

With the soothing sand

That fills each wound.

 

Ours was an unsteady relationship,

Seaweed covered driftwood

Slid beneath our feet

As we slipped and stumbled

Over the flots...

Read and leave comments (3)

🌷(4)

Welsh Poets.David Subacchipoetrysea

Fear~Fear

{Fear--Fear} 

 


Well fear

can most

certainly be a

traumatizing

experience

and definitely

keep us up

all night long

but you have

to believe in

your faith

and that

makes one

fine pillow to

rest their

weary head

upon all

your life

long 

 


And to keep

that fear away

at bay and

never lose

your faith

because

remember

...

Read and leave comments (3)

🌷(1)

poempoetrywriting short storieswriting short poemsTina Gloverwriting short poetrywriting out loudOne_Pissed_Off_American_Ghost_Writer/Tina Glover

Flirting With Death

{Flirting With Death} 

 


All the sleepless

nights and all the

unsuccessful

countless

attempts of

flirting with

death and all

the dark fears

that's held

deep down

inside of you

because death

always awaits

you and me

and all the

never ending

thirsting of the

loneliness of

flirting with

death until

my very

lasting

breath's 

...

Read and leave comments (0)

Dark poemsdark poetrypoempoetrywriting short poemswriting short poetryTina Gloverwriting out loudwriting storiesOne_Pissed_Off_American_Ghost_Writer/Tina Glover

Love Me The Same

{Love Me The Same} 

 

 

Darling all I

ask is that

you love me

the same like

I do you 

 

Because I

don't require

diamonds and

pearls I reqrire

your love 

 

Because we

both can have

a life filled with

love unconditionally

without hesitation

until we both

rise up in hit

our ever

lasting fame

because this

dame will...

Read and leave comments (0)

🌷(1)

One_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryquotesTina Gloverwriting out loudwriting short poemswriting short poetrywriting short stories

?The Fire In Your Eye's?

{?The Fire In Your Eye's?}

 


The fire in your

eyes covered my

soul devouring it

to the lasting drops

of it like good old

mountain spring

water on a hot 

summers day 

 


And as the fire grew

intense in my soul

for you and as the

day's washed away

into the longing

hours of the

lonely nights

while every

second of the

night made me

more...

Read and leave comments (0)

One_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryThinking Out LoudTina Gloverwriting out loudwriting short poemswriting short poetrywriting short stories

Secrets Inside

{Secrets Inside}

 


So many different

secrets inside of

my mind that

makes me want

to know how it

would feel to

embrace my lips

with yours as we

lock eyes lost in

that loving gaze as

we both slip off to

that time slip place

where we can be

on automatic repeat

because this is one

of my favorite secrets 

 

 

 

©Tina Glover All Rights Re...

Read and leave comments (0)

Secret poemswriting short poemswriting short storiesTina Gloverwriting out loudwriting poetrysecret poetrypoempoetryOne_Pissed_Off_American_Ghost_Writer/Tina Glover

How Could You Miss Something You Never Had?

{How Could You Miss Something You Never Had?}

 

 

It's sad to say

that for a long

time now I

would be missing

you but in reality

how could I

miss something

I never really

had in the

first place 

 

Yes it started

off by me

missing the

sound of your

deep voice 

 

And the tender

touches of your

hand against

my skin

 

A...

Read and leave comments (0)

humorous poemshumorous poetryOne_Pissed_Off_American_Ghost_Writer/Tina Gloverpoempoetryshort poemsshort poetryshort storiesTina Gloverwriting out loud

Holding Your Tiny Hands {Cody}

{Holding Your Tiny Hands}{Cody} 

 

 

My dearest son,

 

I remember when you was born at 12:30 p.m. December 17 

 

And then the doctor's laid you on my chest and as I wrapped you up in my arms and kissing your small tiny hands and face as the happy tears flowed down my cheeks 

 

And then I started to count your small fingers and toes making sure all of them was there 

 

...

Read and leave comments (5)

🌷(1)

memoriesOne_Pissed_Off_American_Ghost_Writer_Tina GloverPoempoem 4 my sonpoetryshort poemsshort poetryshort storiesTina Gloverwriting out loud

She Misses Him Badly

{She Misses Him Badly}



They shared

something so

beautiful and

something so

deep and true

but that truthful

lustful love affair

ended to soon

between them

because he

didn't believe

her so she went

on her way no

matter how much

she cared or loved

him and so much

she wanted to

stay but she

knew that if she

did they would

only hurt eac...

Read and leave comments (0)

🌷(2)

Fictional characterfictional pieceOne_Pissed_Off_American_Ghost_Writer/Tina Gloverpoempoetryshort poemsshort poetryshort storiesTina Gloverwordy queenwriting out loud

Walk A Mile In My Shoe's

{Walk A Mile In My Shoe's} 

 

 

Walk a mile in

my shoes

because I was

left alone

without no

money and no

family at the

age fifteen to

comfort and

love me while

my life started

to spin out of

control hitting the

ground full blast

like a nuclear

weapon blowing

the world up

around me

Bam~Bam,

Boom~Boom,

Bang~Bang

this isn't the l...

Read and leave comments (0)

Wordy queenWriting out loudOne_Pissed_Off_American_Ghost_Writer_Tina Glovershort storiesshort poemsshort poetrypoempoetryTina GloverFictional characterfictional piece

Transatlantic Verses - online open mic

I am hosting an online open mic using Zoom.us conferencing software beginning at 7 pm (UK time) on 1 July 2018. We will use Zoom.us teleconferencing software (meeting ID 260-756-986) and take turns reading our poems out as you would in a physical open mic. With luck, we will have a few poets from Britain and a few from the US as well. If people join from other countries, that is even better, but t...

Read and leave comments (1)

onlineSpoken Word poetrypoetryOpen Mic

Thought of a restless mind.

As I grow, I see many places to live by
I see the true nature of life,
On how doll and peaceful it can be.
But what is life without sorrow?
What is life without dreams of the melancholic soul? 

Just a thought of a restless mind. 

-G.N.D

Read and leave comments (0)

thoughtslovefamilydreamslifenewhappysadpoetry

Your Sparkle


{Your Sparkle}

 

 

I love the way your

eyes dancing and

sparkle when you

laugh and giggle 

 


And 

 


I love the way take

time out of your

day to ask if I'm

okay and when you

send me messages

that touches my

heart right from

the very start 

 


And 

 


I love the way you

have opened my

heart to be able to

love again after...

Read and leave comments (3)

🌷(2)

Love poemslove poetryOne_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetryTina Gloverwordy queenwriting out loud love for himwriting short poemswriting short poetrywriting short stories

He Is A Mystery

{He Is A Mystery}

 

 

He is a man

that is a

mysterious

man because

he is a

carrying man

that's always

been kind to

me but the

thing is that he

keeps me

thinking and

wondering what

I'll get when I

meet him face

to face and I

often find myself

thinking of what

color his eyes are

and if they'll dazzle

me when I glance

and gaze in...

Read and leave comments (0)

Poempoetrywordy queenwriting out loudTina Gloverwriting short poemswriting short storieswriting short poetryOne_Pissed_Off_American_Ghost_Writer /Tina Glover

His Whisper's In My Ear

{His Whisper's In My Ear}

 

 

He always

whispers sweet

desirable sexual intoxicating love

in my ears 

 

 

And when he

leans my head

back slightly

pulling my long

hair back while

kissing my neck

as he nibbles his

way down my

desirable hot

body leaving my

body shaking

with excitement of wanting him as

I nibble on my

bott...

Read and leave comments (2)

🌷(2)

Erotic poemeroticalustful poemslustful poetryOne_Pissed_Off_American_Ghost_Writerpoempoetryshort poemsshort poetryshort storiesTina Gloverwriting out loud

Nothing Last Forever

{Nothing Last Forever}

 

 


As nothing last

forever and we

need time on our

own to find our

way out there

and through this

cold blue november

rain that keeps

blowing this pain in

and out of our lives

and don't you

dare look into my

eyes because you

will still see

there's love inside

of them burning

for you still but

we both are so

mes...

Read and leave comments (2)

🌷(1)

poempoetryTina Gloverwordy queenwriting short poemswriting short poetrywriting short storieswriting out loudpainful love poemhurtful love poetrysad poetrysad poemlove poemlove poetrysad love poemsad love poetryOne_Pissed_Off_American_Ghost_Writer/Tina Glover

I Am Always Going To Be Missing You

{I Am Always Going To Be Missing You}

 


I am always going

to be missing you

like the skies are

missing the bright

stars shining

brightly through

the heavy rain and

then when I

remember those

stars I remember

that is you and

you're beautiful,

handsome rough

rugged face

shining back down

on me and as I am

still here missing

you no matter how

...

Read and leave comments (0)

🌷(1)

Love poemsTina Gloverpoempoetrylove poetrylifewriting out loudwriting short poemswriting short poetrywriting short storiesOne_Pissed_Off_American_Ghost_Writer /Tina Glover

Death Warrant

{Death Warrant}

 


I have an active

warrant for my

scheduled death

that has been

killing me slowly

and painfully since

the day I was

conceived inside of

my mother's womb 

 


And as these day's

fade into the darkest

longest hour's of the

lonely nightmares of

death lingering

around my sickened

weakened body until

I am a forgotten

chiari w...

Read and leave comments (1)

🌷(1)

Death poemswriting out loud poetrylifedeathsadnessawareness_4_chiariwordy queenOne_Pissed_Off_American_Ghost_Writer/Tina Gloverdeath poetrydeath storiespoempoetryChiari_101

I Don't Fear Death

{I Don't Fear Death}

 


We all live 

 


We all die 

 


We all cry 

 


We all suffer while

we are trying to live

in this life while we

just simply wait for

death to creep in

on you 

 


And we all love

everyone that is

actively in our lives

daily and we love

hard and we love

deeply as we possibly

can because believe

me tomorrow i...

Read and leave comments (0)

Awareness_4_ChiariChiari_101death poemDeath poetrydeath short storieslife with chiariOne_Pissed_Off_American_Ghost_Writer /Tina GloverpoempoetryRare DiseasessadnessTina Gloverwordy queen

Culture

Pound shops and takeaways,

salons for grooming of

dogs and their owners

sit side by side.

 

Rancid fat acrid

in back alley junk piles,

settees and Christmas trees

slowly decay.

 

Damp homes

in damp climate

for cotton mill workers

no longer needed.

 

The forest of chimneys

now superseded

by new build in miniature,

room sizes shrinking,

 

l...

Read and leave comments (2)

🌷(3)

modern lifeCulturecapitalismpoetrypovertycottonmillIndustrial Britain

The Slam

The Slam

 

They told me we would do a slam

Of odes and poems and wham bam mam

Our words and rhymes would fight it out

We mustn’t mutter, better shout!

A ittle like a boxing bout;

So off I went to start to train

Like Rocky, in the ring again.

 

My female rival? Well, I’d beat her,

With exercise of regular metre.

My metaphors would pack a punch

I’d knock em dea...

Read and leave comments (3)

🌷(4)

poetry

Obsessed With You

I'm addicted to, all the

Things you do. The way

You look at me, make me

Breathe. I can face this now,

With you I now know how.

Your words enlighten me,

Your eyes, they help me see,

I've never felt this free.

 

Read and leave comments (0)

🌷(1)

addicted to youfreefreedomloveunconditional lovelusthappysafehopestrengthgroundedenlightenedpoetrylove poemsromanticromancelove poetry

Real Life Nightmare

Every moment to fear,

Forever holding back internal tears.

Life- so complicated,

forever indecisive.

The world too big, too scary,

my mind so full of queries.

Never certain, never happy,

each decision could be deadly.

An escapes impossible,

every outcomes implausible.

Sinking under water,

Always being taken for a martyr.

The pain runs so deep,

Barely able to ...

Read and leave comments (3)

🌷(2)

anxietybattlecomplicateddangerdarkdeepdesperationdestructiondrowningemotional painemotiveescapefearFrom the hearthopeindecisiveinternal battlemental healthmental health issuesmindnightmarepoetrypoetry and mental healthsanitysinkingsubconsciouswar

Timeless Temptation

{Timeless Temptation} 

 


He had lips like a

sweet soft angles

lips that made my

heart melt away

to rubbish 

 

 

As his eyes

sparkled in mine

like the starry

skies above my

head 

 


But his words

was intoxicating

to my ears as the

sound of his heart

and mine pounded

loud and louder

until I no longer

could hear his

words just th...

Read and leave comments (1)

🌷(1)

Poempoetrylove poemlove poetrywordy queenshort poemsshort poetryshort storiesTina Gloverwriting out loudOne_Pissed_Off_American_Ghost_Writer/Tina Glover

Life's Expectations

{Life's Expectations}

 

 

Life isn't what we

think or expect it

to be 

 

Because life can be

filled with hurt, pain,

sickness, death, lying,

cheating and

bamboozled with

condensing pricks

that only seems to

think of themselves

and no one else in

life no matter how it

effects the other

person in the situation

at hand 

 

 

Because my ...

Read and leave comments (0)

🌷(2)

fictional characterLife poemOne_Pissed_Off_American_Ghost_Writer/Tina Gloverpoempoetryshort poemsshort poetryshort storiesTina Gloverwlife poetrywordy queenwriting out loud

The Washing Line

Down dark cobbled back streets, clothes lines stretched 
across cohorts of back yards, on Washing Day.
Regiments of white bed sheets hoisted high
flapping like flags,  in threatening skies 
supported by proud, 
immoveable clothes props. 
Garments not daring to fly loose, 
Straddled by dolly pegs 
forced down hard.

Above boiling bleach buckets  
Malevolent steam swirled, silently seethi...

Read and leave comments (6)

🌷(4)

poetrymemoriesLancashire

Once

{Once}

 


Once I held his love

and affections so

deeply embedded

into my heart so it

would never apart 

 

 

Until the day my brown

eyed rough tough with

the heart of perfection

left my side when an

horrible accident

happened that's when

my heart was ripped

straight out of my chest

leaving a gaping hole

there where his love

once remained at 

...

Read and leave comments (0)

PoempoetryTina Gloverlifelivingsad poemssad poetryloving himOne_Pissed_Off_American_Ghost_Writer/Tina Glover

His Love

(His Love) 

 


His love had grabbed

her heart at first

sight and she began

to fall in love with

this man because

the poetic word's

he wrote to her

and it made her

heart rhythm

pick-up pounding

faster and faster

for him and his

word's was slowly

being engraved upon

her damaged layers

of her heart easing

her weary mind about

reopening her hea...

Read and leave comments (4)

Love poemspoempoetrywritingwordy queenTina Gloverlove poetrylove poems for himOne_Pissed_Off_American_Ghost_Writer/Tina Glover

Still 23

Still 23

I’m 46 next week, but I’m 23 inside,
It’s not just old age denied.
I know my body’s knackered
‘cos daily I’m reminded:
the mirror’s getting scary,
I’m sure my face is puffy.

I used to feel so fit and strong,
stand up in the pub and sing a song,
Give me a coffee, I don’t want a pint,
I’ve no time for fools or picking a fight.

I think I’m pretty cool,
my daughter’s face sa...

Read and leave comments (6)

🌷(4)

humourpoetryAgeinggetting old

After Breakup

A lot of pain in the ribs
I have forgotten her words

It has come to understand the foolish
The pains have taught all

I saw happiness in my tears
He found happiness in his smile

Read and leave comments (0)

Poetrylove poetry

Headphones and Wine bottles

Not exactly dressed for the kill-

Hell, she can’t even walk

In a straight line-

But she’ll still be able to find her way

To you.

In these heels,

In those thoughts,

She dances with wine bottles

While headphones play

Some song

That had nothing to do with you.

Bare feet circle bare floors;

Bare hands hang onto

Bare walls-

Or the toilet seat.

She feels poet...

Read and leave comments (1)

🌷(4)

poempoetryheadphoneswineheartbreaklust

"Cry in Sorrow"

Broken and left in sorrow,
Through my tears I speak my fear for the morrow
Winding time back is the only relief
While this empty shell decays
And tears apart the last glimpse of life.
 

Read and leave comments (1)

🌷(3)

poetrylitcreativewritingsorrow2018deathdesperation

What Is Freedom?

Insidious, drip, drip, drip,
manipulation,
until normality
is life in a cage
of words and looks.
Like a dog that stands there docile,
the rope untied.

Some words do hurt,
do stick.
The most powerful,
parasitic,
worm into the mind,
unnoticed, unchallenged,
apparently innocuous,
sugar coated lies
on the nature of reality.

But a mind awakened
in the vast realms
of consciousness,
...

Read and leave comments (3)

🌷(5)

freedompoetrysocialcontrolpropagandamodeloppressionmanipulationconsciousnessawarenessselfactualization

Full Circle

Full Circle 


It’s here again. Bring the tissues. Hide away the blades. Its coming

full force

Into our home, our hearts, our souls, here. It’s in                                                                          

My mothers eyes as she stares blankly, unblinking, it’s in

nanna’s shaky voice, breaking. ‘what were you thinking?’

Its carried in by broken promises, screams th...

Read and leave comments (1)

🌷(2)

poetryfearhopeeternity

Process

what spills onto         the page

falls from                  my mind:

it tells of                   what is there

it tastes of                 my thoughts

so they are                spread here                      with care

                                                                        as verse

the page                    becomes

my mind                    bared

...

Read and leave comments (0)

🌷(2)

influencepoemspoetryprocessreadingversewriting

To be...To become...

Why won’t you write me…
Lay me down on paper…
Like your time on a string…?

Don’t speak of me…
Just, lay me down…
Not for glory, or money…
But just to help me be…

Let me be your song…
Your poem…
Let me be your love…
Your work of art…
Write me down!!!

Let every word be your sword…
Every verse your dagger…
Stab that paper with your tears…
With the silence of your fears…
No one w...

Read and leave comments (4)

🌷(3)

To be...To becomepoetryxoanxopoem

How can I?

Can I write something beautiful tonight,
find the beauty in your eyes…
If they are nothing but the mirror of mine?

I want to write something beautiful tonight,
I want to sing, dance, laugh,
to scream…
To love,
I want to shout,
to cry,
I want…
Most of all,
to cry…

I want to write something beautiful tonight,
to talk of lovers, dreamers,
heroes, winners…
Of the beauty of every smi...

Read and leave comments (4)

🌷(4)

how can I?xoanxopoetry

Coffee Shop Blues

Bakers and coffee shops

Line the streets,

And I find myself

Nestling inside a few

To find a comfort

Only coffee beans and bacon

Can provide.

Warming cold hands

From frost;

Warming strangers to the

Idea of companionship

And togetherness.

Wholeness.

Mugs and teaspoons

Hold a special place

In my heart;

Teapots and saucers have

A special kind of solac...

Read and leave comments (3)

🌷(3)

poetrypoembakersbloggingcreativecoffeewritingshop

I want this to last forever

The greatest smile I have ever seen,
the most gorgeous voice I'll ever hear,
with stunning eyes that turn me to stone,
I feel like a child when I'm around you.

The little time that we spend together,
I wish it would last forever.
Talk about nonsense,
yet laugh at everything.

We create memories,
with only our fingertips,
never mind the spoken words that cannot be heard,
we make promi...

Read and leave comments (0)

🌷(1)

poetrycrush

I can see your face in dry paint

The answers you gave,
the truth you didn't speak,
were the things I wanted to hear.

We still have our habits,
we still live our old lives,
hiding the things that shouldn't be seen.

What do we get if our feelings hide in secrecy,
what do we do when the things we love aren't real...

Somehow I love you,
I don't know why,
I need you.

With the energy I have left,
I reach for the rem...

Read and leave comments (1)

🌷(4)

poetrypoem

Fear

{Fear} 

 

 


The morning dew is

on my shoes the birds

are chirping and singing

their tunes as the

morning sun brightens

up the sky with warm

crisper air that made

you take a deep breath

into your lungs waiting

to exhale 

 


And 

I fear 

 


And as the birds goes

silent and the clouds

went a dark bluish gray

with the sun gone

behind t...

Read and leave comments (2)

🌷(1)

Fearfictionfictional piecelifelivingOne_Pissed_Off_American_Ghost_Writer/Tina GloverpoempoetryTina Gloverwordy queenwriting short poemswriting short poetrywriting short stories

Take Care

{Take Care} 

 

 

 

Take care too, Friend.

There are times I want

to hide from the sun too,

so I at least know how

that part feels like.

Thing is,

there's so little sun

here anyway that even

walking about in the

fresh air seems like a

being under a rock

at times.

I never not wanted

to be your friend,

ma'am and I hope

we can put this

behind...

Read and leave comments (0)

🌷(2)

fictional piecefriendshiplifelivingOne_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryshort poemsshort poetryshort storiesTina Gloverwordy queenwriting out loud

Tanga

Lakas ng kapit sa memory ko

hirap kalimutan

nagmumukha na akong baliw

kakausap sa sarili ko

na huwag na

hindi dapat dahil sa kanya

wala ka naman

iniiwasan naman

sa panaginip naman nagpaparamdam

bakit hindi mo ayusin

mukhang kang tanga

Read and leave comments (0)

poetrytagaloghiddenlove

I'm Out Of My Head

{I'm Out Of My Head}

 


Rose's are red,


Violet's are blue,


I'm out of my 

 

head with thinking

 

of you 


and all I want to

 

do is to go to

 

sleep to dream

 

of you all

 

the same 

 

 


©Tina Glover All Rights Reserved/ One_Pissed_Off_American_Ghost_Writer 2016 but posting here on April 14,2018 

Read and leave comments (0)

🌷(2)

lifelivingOne_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetryTina Gloverwordy queenwrite out loudwriting short poemswriting short poetrywriting short stories

I See So Clearly

{I See So Clearly}

 

 


Well I set here with

all this shame and

guilt of what I've

done but nothing

can never undo the

hurt I have caused

you

 

 


And lord knows

I hate myself for it 

 


And how I was

so wrong 

 


And I hope one day

that you will be able

to forgive me for

my hurt and damage

and tears and pain I have

done and ...

Read and leave comments (0)

Poempoetryfictional piecewriting short poemswriting short storieswriting short poetrywriting out loudstorieswordy queenhurting poemshurting poetrylifelivingOne_Pissed_Off_American_Ghost_Writer/Tina Glover

My Illusion's

{My Illusion's} 

 


I am having back to

back illusion's of you 

 


And I'm wishing and

seeing you in the faring

clearing distance of the

hot burning desert

sands of our life

packed into an hour

glass bottle

 


And as the sands of

time starts to run out

for us I look a little

bit closer and I see

you slowly disappearing

once again from my sig...

Read and leave comments (0)

fictional characterfictional piecelifelivingOne_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetrystoriesTina Gloverwordy queenwriting out loudwriting short poemswriting short poetrywriting short stories

I Maybe Fragile

{I Maybe Fragile}

 

 


I maybe fragile but I am

me I will battle back

with all I have inside 

of me until I no longer

can continue my battle 

 

 

And just because I

am fragile doesn't mean

that I will break if you

touch me 

 

 

And I may get a little

bit but more than likely

nothing will happen

so don't be alarmed

and afraid of me or

...

Read and leave comments (0)

learninglifelivingOne_Pissed_Off_American_Ghost_Writer/Tina GloverPoempoetrystoriesTina Gloverwordy queenwriting short poemswriting short poetrywriting short stories

New Mills Festival Poetry Trail

I'm putting together a poetry trail for the New Mills Festival. The festival begins 14 September and runs for three weeks. Poem will appear in shop windows throughout the town. We will have a round-robin poetry reading for participants on 26 September 2018 at The Butterfly House at the Torrs. The deadline for submissions is the end of May, but I'm accepting poems as I go, so it is best to get them...

Read and leave comments (0)

call for submissionspoetrypoetry trailsubmissions

Show more entries …

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message