Donations are essential to keep Write Out Loud going    

poetry (Remove filter)

DAYS OF OLD

Why am I so unfortunate?

You ever wonder that?

Because I do, and wonder

Why am I always begging at the hands of others?

You know, those who strive to thrive unlike me,

Because I, I stare at walls.

 

I wonder,

Why does the wind change direction in my world?

It’ll blow north, south, east and even west,

All directions but mine,

Why does it never blow in my face?

Wh...

Read and leave comments (0)

🌷(3)

poetry

Labelled

Becoming slowly unrecognizable to yourself and others
Feelings and thoughts take
a hold, giving you the shudders
Memories and emotions that seem to flood your heart
Faces and places making it hard to know where to start
Decisions throughout the day, waiting to be made
Resting again in bed where it all just seems to fade
Urges of wanting help yet not knowing what to say
Triggers causing you...

Read and leave comments (1)

🌷(4)

poempoetrywritingmentalillnessmentalhealthrhymerhyming

Valentines

Taking time out on a couple of dates for one
May seem lonely or anti social for some
But having space to yourself - mostly all alone
Shows a few changes that you have outgrown
Valentines Day - being a special one for lovers
A time of anticipation and kindness for others
Loving yourself by being your own best friend
A journey in itself which doesn't need to end
A card, message or present yo...

Read and leave comments (0)

poempoetryromanceromanticvalentinesdayvalentineswriting

Valentines Day

Dressing up, styling hair, feeling fine
Card and presents, wait to be opened, all in a line
Roses, chocolates and bottles of red wine
Celebrating Valentines Day, its just a matter of time
Happiness shown, whether it be rain or shine
Cupid wasn't so stupid, sending his arrow as a sign
The restaurant booked, we drink and then we dine
Thinking that when we met, he must of made you mine
More s...

Read and leave comments (0)

poemspoemwritingvalentinesdayvalentinesromanticpoetry

New Years 2023

As the year of 2023 comes to a relieving close
We think over the good and bad times we chose
Memories stack up again and then begin to fade
Thinking up New Years Resolutions to be made
We begin to look to the joys of a fresh New Year
Where we start to wave a huge good-bye to fear
Tears and worries that consumed part of 2023
Are left behind as the New Year brings a new me
With the help of R...

Read and leave comments (0)

poemspoetrywritingrhymenewyearsnewyear2023

Spring

There's something about this season, Spring
Waking up to birds as they, sing
Trees and its blossom show subtle, pinks
Clouds and rain, for thr earth now drinks
The sun reappears, having such a glow
As if it were trying to say, hello
I go to the garden to walk around
To see what other things are found
Butterflies with their colorful wings
How this season holds such beautiful, things.

Read and leave comments (0)

poempoetrywritingspringrhymerhyming

Lockdown

Going to bed then waking up late, what lies ahead?
We ask you fate
Jogs in the winter sun around the area,
Becoming healthy - losing weight
With hope in the vaccine and wanting to be immune
We look to this date
Remembering things of the past, finding comfort
Talking to a mate
Thinking what we have done and future plans
Good and bad times we know await.
 

Read and leave comments (0)

poetrypoemwritingrhymelockdowncovid19

Separation

No matter how much the shouting, its the inside worth counting
Never mind harsh words of a person, their actions could never worsen
Others with a listening ear, may take away the fear
The unknown goes on behind closed doors, hiding all the flaws
Love seemed a while away, yet so did the other day
Fondness comes after the trouble, back to how things were, a couple
Smiles are exchanged, somehow...

Read and leave comments (0)

poempoetrywritingliferelationshipsrelationshipsending

Misfortune

Letting someone else's light shine brighter than mine, isn't such a prideful crime,
I should listen to what people have to say, to have the attitude of 'come what may',
Speaking my mind being always kind, the truth is what I then, shall find,
I think, I think, I think too much, I would rather not about such and such,
I learned to appreciate from a distance, family and friends, I love within an...

Read and leave comments (0)

poemwritingrhymepoetryreal life

Written in Stone

an epitaph
covered in overgrown grass
numbers and a letter encrypted,
written to the deceased,
for only those who knew him
you’d truly understand

Read and leave comments (0)

🌷(4)

familyfriendsdeathlovegodspiritualspiritualitynaturemetaphysicsmetaphysicaloccultpoetpoetrypoempoemswriterwriting

Hot Spring

the plumes of a caldera,
and the dark clouds,
sun overshadowed,
at its core a scalding heat turned colder
because of similarities
shared this simile
for the changing of seasons, anew
an unforgiven embrace

Read and leave comments (0)

beachsummerseasonspoetpoetrypoempoemswriterwritinglovenaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Table Manners

he wouldn’t let us leave
without paying,
for our meal

had to-go

then bantered with them
and, you ordered to make him take it back

the whole ordeal was a real headache,
I could feel tension in the temple,
and had to meditate, to
clear my head and relieve the stress

I wanted to post a pic of my meal,
but it was almost traumatic

Maybe, I’m just being over dramatic?

Read and leave comments (0)

dinnermakeuplovepoetpoetrypoempoemswriterwritingnaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultart

size them up

had me my hand me downs
and, we all know too well known
if the shoe fits wear it

nicest stuff is worn out and she wore my XXL shirt around the house
her chores, get done…
one bra in the wash and no panties on

The first steps
commemorated with expensive shoes,
soles being broken in,
a mash of burning glass,
molten sand and in it,
it’s silica content

Read and leave comments (0)

🌷(7)

cinderellaglassartworkartpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovemakeupfashionmodel

approach with caution

veered off, routine stop, in the shoulder…
looking over your paper work,
keep your hands on the steering wheel,
“I’m not going to ask again”
repeated offenses
respect my authority

police officers
a ford mustang and dodge charger

government funded electric vehicles
take a look inside the hood, it
purrs like a street cat with a scratchy throat

cut the lights on and off
I’m just try...

Read and leave comments (0)

USApolicecarpoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccultlovecreativeartartwork

phishing

attempts
online attachments
“Hooks & Worm” viruses
hosted— a parasite

on the web
spider crabs
In their net

Read and leave comments (0)

funfriendsbeachsummerpoetpoetrypoempoemswriterwritinglovequotesquotenaturegodspiritualityspiritualmetaphysicsmetaphysicaloccultinternetviral

: From A Fractured Time :

A moment in time did happen once.

                It was there and then it was no more!

Like a fickle wind that took a chance,

                To raise a head, but was gone before!

 

I would mull often in vacant times.

                If such a moment did occur awhile!

Or was it something without rhymes,

                As in the whimsies of a juvenile!

 

As ephemeral...

Read and leave comments (0)

🌷(5)

PoetryMusememoryabstractnostalgia

walk the line

My turn
I’m going to
spin the bottle
no one ever even noticed me
in High School
our first kiss
needs to be perfect
you don’t get a redo

Read and leave comments (0)

🌷(6)

bottlealcoholdrinkshighschoolpartylovepoetrypoetpoempoemswriterwritingoccultmetaphysicsmetaphysicalspiritualspiritualitygodnaturemodelfashionmakeupbeauty

love-hate relationship

obsession …
— envy us
in the way they stay upsetting
themselves.

you’re setting yourself up for failure

possible optimism

two glasses
my other, half
fully blurry vision
they’re prescription
usually she has to squint
and hadn’t felt the planets tilt till now

Read and leave comments (0)

🌷(1)

mediacouplefamousmodelfashionmakeupbeautylovepoetpoetrypoempoemswriterwritingnaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Red Dye Number 40

in pursuit of riches
snapped twigs, and
perseverance
exhausted —
all my resources …
gone,
in the heat of the moment.

Read and leave comments (1)

🌷(2)

moneybusinessmogulfashionmakeupmodelbeautylovepoetrypoetpoempoemswriterwritinggodnaturespiritualspiritualitymetaphysicsmetaphysicaloccult

Lost Angels

martyred
Tupac Amaru Shakur
Los Angeles

thug poetry

40 ounces of malt liquor
Olde English and calligraphy

slurring my words…
sounds as if I’m speaking in cursive

Read and leave comments (0)

losangelestupaccitystatecalifornialovepoetrypoetpoempoemswriterwritingspiritualspiritualitygodnaturemetaphysicsmetaphysicaloccultbeautyfashionmakeupmodel

Welcome

take your shoes off at the door

I’ll take your coat

your hair smells refreshened
from the ozone
and
remnants of soap
lathered and rinsed out
in the rain shower

Read and leave comments (0)

fashionmakeupmodelbeautyweddingmarriedcouplelovepoetrypoetpoempoemswritingwriternaturegodspiritualspiritualitymetaphysicsmetaphysicaloccult

Rhetoric

attacking my integrity

questioning… me

myself,

I, was taught there was no such thing as a stupid question

second guessing…

why?

you were impolite.

looking for answers in an inner view

Read and leave comments (0)

🌷(1)

interviewquestionsanswertruthspiritualspiritualitygodmetaphysicsmetaphysicalnatureoccultlovepoetrypoempoetpoemswritingwritermakeupfashionmodelbeauty

Stars and Stripes

big brother
little kids,
children in the middle
of
civil war torn nations

warring

civil discourse

say your prayers

“Our Father”

we gather together to ask for salvation

Read and leave comments (0)

warcivilnationUSAarmylovepoetrypoempoetwritingpoemswriternaturespiritualspiritualitygodmetaphysicsmetaphysicaloccultbeautymakeupfashionmodel

High Performance

Spun -
A burnout —
driven to madness
and
crashing,
in a
drug fueled accident

What a catastrophe!

Read and leave comments (0)

depressedhappylovequotespoetrypoempoetwriterwritingpoemsgodspiritualnaturespiritualitymetaphysicsmetaphysicaloccultfashionmakeupmodelbeauty

Substance Abuse

You laid it down before me
Stuck the dollar in my nose
Got me breathing fast
Had me feeling trashed

One dose had me down
One hit and I begged for more
One more hit
One more kiss
One more line
One more night
Until my body went cold

Laced with poison
You decieved me
Lied about what you sold
And now I can't shake this crave
I can't shake this pain
I can't shake you from my brain

...

Read and leave comments (0)

🌷(4)

poetrytraumapast

verse on a hill

A known quantity bereft of quality;
a name of little beyond its letters,
by road’s shoulder perhaps guide

to openly weep a slippery slope
of once having known someone’s art
yet lay hold naught of their heart

eternally flowing river of kindnesses
shall meander, thoughts ever caress
even when words and faces now drift

a familiar feeling remains here still
years invested this regenera...

Read and leave comments (0)

🌷(6)

poetry

Star-Crossed Hearts

She was poetry, a dance in the air
Moving lightly, like a verse floating there
Hair in the wind, unpretentious lines
Her smile illuminated cloudy times
He, a simple man, lived raw prose each day
With calloused hands, unaware of the way
Life in bold letters, beauty lost in the grind
Chapters predictable, meaning hard to find
At the craft fair, a sun shining bright
He watched from afar, not...

Read and leave comments (0)

🌷(4)

poetrydancemanletterssunnamesstarslovelifeyoucoragesky

Infinitesimal

dimensional
cellular division
the genomic sequence

time is a light matrix
encoded in
0’s & 1’s
goes on forever …
and, in that order
10, 9.

A singularity
and absolute zero

the big freeze or heat death

he said no one can help us
when, asking the universe
for answers

what, times any number
… is nothing other than zero

Read and leave comments (0)

🌷(5)

mathmathematicsschoolpoetpoetrypoempoemswritingwriterusanaturelovefashionmakeupbeautyspiritualspiritualitymetaphysicsmetaphysicaloccultgod

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

🌷(1)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Blue Moon

This tidal,
ebb and flow
of our own
mixed feelings
as a solution,
salted tears …
we are 60% water
with
these waves of emotion

Read and leave comments (0)

moonnewmoonfullmoonritualmagicmagickspiritualspiritualitymetaphysicsmetaphysicalgodoccultnaturelovepoetrypoetpoempoemswritingwriterfashionmakeupbeauty

Family Ties

ancestors
shackled
and put in line
following the customs
of those, who
came before them
 

Read and leave comments (0)

natureUSAgodspiritualspiritualitymetaphysicslovepoetrypoetpoempoemswritingwriterbeautymakeupfashion

Moral Support

We shouldn’t be embarrassed
to talk
…. about our problems
to a therapist

always looking at me, before you speak

I’m here for —You
if ever
you feel the need to talk about anything.

Read and leave comments (0)

therapydepressionmentalhealthlovepoetrypoetpoemwriterwritingmetaphysicsoccultgodUSAfashionmakeupbeautynature

Trojan Horse

Generation X
plagued
with
this ease
that is,
going viral…

Read and leave comments (0)

sexlovebabyspiritualspiritualitymetaphysicsgodcreationpoetpoetrypoempoemswritingwriternaturefashionmakeupbeauty

Web of Lies

Paralyzed
like a spider
checking in on his victim
tied up, entangled …
makes me think
of a bad dream
worsened
the familiar feeling of
waking up to the news of death

Read and leave comments (0)

spiderbugsnaturegodspiritualspiritualitymetaphysicsoccultUSApoetpoetrypoempoemswriterwritingfashionmakeupbeauty

smooth...

They say he has his way with the ladies
the bruiser at the door
thought to himself
hey, let’s not get carried away

what a light weight ...
they had been seen leaving together
after a fight—being broken up
over a year at least

she said to all her girlfriends
“it was like I was blinking
then my eyes rolled back
into my head and everything went black”

Read and leave comments (0)

alcoholbardrinklovegodspiritualityspiritualmetaphysicsnaturepoetpoetrypoempoemswritingwriterfashionmakeupbeauty

Bible on a night stand

intermingling with a demon in the flesh
you realize your life was a lie
and your soul suffers in hell
for what feels like an eternal
date with death

Read and leave comments (0)

godspiritualitybiblespiritualmetaphysicsoccultnaturelovepoetpoetrypoempoemswriterwritingUSAfashionmakeupbeauty

Ebonics

A child
talking black
to their parents
acting out of character
arguing about upbringing
taken back
some things are best left unsaid…

Read and leave comments (0)

USAcrimeamericapoetrypoempoemspoetwriterwritinglovenaturegodspiritualspiritualitymetaphysicsmakeupbeautyfashion

Dark Side of the Moon

prophesied
the premonitions
foreshadow people
who live lives with
similarities parallel to our very own

when your third eye intakes light
and all the shades disappear in the night
their life is vibrant
the dream seen as an auric phenomenon
it’s either that
Or, are you completely isolated
in the back of the black of your eyelids

see an oracle or dream interpreter,
our aura’s rainbo...

Read and leave comments (0)

natureusagodspiritualitymetaphysicsspiritualpoetpoempoetrypoemswritingwriterlovemakeupfashionbeauty

Fog of War

smoking barrels
in talks —about the past
around the campfire

you could cut the tension with a knife

the only thing needed is a good sense of humor

And,
…try not to lose your self along the way

the buddy system
marching—
side by side
do you trust that man with your life?
willing to take a bullet for them?
behind every great man is a great woman…

Read and leave comments (0)

warusacrimearmylovepoetpoetrypoemwriterwritingnaturemetaphysicsspiritualitygodmakeupfashionbeauty

Sweating in my Sleep

This is a dream full of desires,
and I like to think
when we go to sleep eternally

our soul
will not be without
the rest in heaven.

Read and leave comments (0)

naturelovepoetrypoempoemspoetwritingwritergodspiritualspiritualitymetaphysicalmetaphysicsmakeupfashionbeauty

Which Tomorrow?

More poetic flash fiction based on the browsing of best selling book titles in under 30 words. Perhaps next time you're looking at a list you'll spot them all!

 

Tomorrow and Tomorrow 

And Tomorrow 

The Last Goodbye

Was the longest 

Then she was gone 

No one saw a thing 

Except for the couple 

At No 9

Read and leave comments (5)

🌷(8)

flashfictionpoetrystorytellingmystery

: The Barren Tree :

It grew in the wilds, a sentinel growing tall,

A mighty yogi in presence, embracing it all!

Branches reaching out, to the skies in a plea,

Seeking for the strength - to live it's destiny!

 

Its ancient bark, a wrinkled, weathered hide,

Tells a tale of the time's, swiftly flowing tide.

Inexorably which has grabbed, life in a churn,

On and onwards to - the lands of no return!

...

Read and leave comments (3)

🌷(7)

TreeMusesBarrenLifeNatureAncientPoetry

The Rich Want To Heal The World, But I Never Knew It Was Sick

You A Masterpiece 

On My Kurt Cobain Swagger 

Can I Ask You Please 

Will You Be My Courtney Love?

Read and leave comments (2)

🌷(1)

poetrypoemspoetlovelyrics

: Soliloquy :

A life had my thoughts, ephemeral and bright!

Coursing thru’ the skies, in a shimmering light.

                    And time reached out, in a glorious embrace;

                    Rushing me breathless, through empty space.

When the memories came, unbidden but true;

From the nether mind the feelings broke thru’.

                    Some moments to rejoice, some sharp agony.

  ...

Read and leave comments (0)

🌷(3)

PoetryMemoryMuseSonnetPastLifeThoughts

Dubbed Subtitles

what I say goes —
if I say so -
don’t allow an application to control anything
they need permission in these settings
and turn down your background music
“for what?”
if I’m going to green light your on screen time

we cannot have anyone getting an extreme close up
portray a picture perfect image

believe me...

flash forward,
when you’re using the front camera shutter you’ll see

y...

Read and leave comments (0)

🌷(4)

spiritualspiritualitygodmetaphysicsnaturelovepoetpoetrypoemfashionmakeupbeauty

I Accept My Reality

I accept

All the things around me

The harsh warmth of an Indian afternoon,

The confused colors of the evening,

Sheer darkness of night regardless of moon,

And everything between the end and beginning.

I have been trying to change my life,

But all I could change was my perspective.

I can’t seem to change the story, Though I attempt to shift the narrative.

I’ll fulfill m...

Read and leave comments (1)

🌷(4)

Poetrypositivityhopefulhealingself lovepatiencecaresimple

The Spectator

Spectator, from your ivory tower you peer,

Through sneers and smears, your wishes are revealed:

That poetry penned by plebs remain concealed,

Of Daffodils, irrational is your fear!

Uilleam Ó Ceallaigh 4th September 2024

Read and leave comments (2)

🌷(8)

daffodilspoetryplebs

: The Voices In My Mind :

All those voices yet in my mind,

From the years I had left behind.

            Casting echoes in that room -

            Pulsing through the dusty gloom.

The floating dust catching the light,

Shivered with unknown disquiet!

            The echoes gathered to surround.

            They animated the space around.

People I loved, now lost with time,

Speaking thru' the years...

Read and leave comments (0)

🌷(7)

Musememorythe pastpoetrysonnet

Pain Relief

When will it go away?

 

The pain in my chest

 

Pain in my stomach

 

Pain. 

 

It’s repetitive and never stops

 

It creeps up on me like bugs

 

Stings like a wasp

 

Bites like a mosquito

 

And leaves, taking a small part of me

 

Some say it’s a part of life 

 

Maybe I don’t want that

 

If this is life 

 

Maybe I don’t want any p...

Read and leave comments (2)

🌷(7)

painlovefriendshipreliefpain reliefhoperegretlossfaithpoetrypoem

Creature of Habit

at times I find myself
with insight
into my third eye
the inward perception
of crystalline tears
holding onto emotions
looking for one thing

The truth

Read and leave comments (0)

🌷(9)

naturedepressedsadlovepoetpoetrypoemgodspiritualspiritualitymetaphysicsmetaphysicalawakeningtruthbeautymakeup

Waxing Poetic

my love letter
stamped with a pair of pressed lips
licked,
then sealed with a kiss

the silent observer.
waiting for his moment
with the present

trying quietly not to mouth breathe aloud
smothered in your undergarments

while fire from the two flames
arose
on a magic candle
over and over

like a brazier come undone

Read and leave comments (0)

lingerieloveprettybeautyfashionpoempoetrypoetnaturegodspiritualspiritualitymetaphysicsmetaphysical

The Vacuum of Space

star dust -
quantum particles —

and, strings ...
from the fabric of the universe

ashes to ashes,
A bindi
black glasses,
fragmented obsidian
and, an asteroid belt

A Shero
— deified
hereafter she received
Saturn’s ring.

Read and leave comments (0)

spacecosmosastrologyspiritualspiritualitymetaphysicsmetaphysicalgodnaturelovepoempoetpoetrybeautyfashion

We Took a Wrong turn

You know what ?
they say,
three lefts make a right.

I’ll go ahead
and, uh…
double back around

now, where were we

we’re here

Where?

There.

well.. then,
why didn’t you just tell me that in the first place

Read and leave comments (0)

streetcartravelnaturelovepoempoetpoetrygodspiritualspiritualitymetaphysicsmetaphysical

Dead End

you need to
... stop
ignoring ...
the warning signs to
turn around your life

Read and leave comments (0)

carstreetlovepoempoetpoetrynaturegodspiritualspiritualitymetaphysicsmetaphysical

Bullet Points

This just in
The faulty firing pin — from a fire arm
had become dislodged
effectively,
causing it to misfire

very briefly …
in acceptance of all responsibility
the city-state committee
has sent a representative
that will be answering questions

now… back to you

in other news
we have a sunny forecast

there’s a color shader
right there, on
this heat map
that has an infrared si...

Read and leave comments (0)

gunsafetyfirearmsusalovepeacefreedomcrimemetaphysicsmetaphysicalspiritualspiritualitynaturegodpoempoetrypoet

Eyes on Me

I don’t want to be seen

 

I don’t want to be perceived

 

I wish I could go anywhere and be invisible.

 

People are everywhere

 

Eyes are everywhere

 

They’re all living their own lives but why do I feel as though mine is being watched?

 

As though they’re looking for a mistake in me

 

Is my hair messy?

 

Is my outfit mismatched?

 

Do I walk wei...

Read and leave comments (3)

poetrypoemlifeeyesanxietyhelpdepression

death of a gorgon

so I become this wrought iron
that I have forged with my own two hands.
I sharpen myself,
tip to hilt.
but
my mouth,
the very blade that can cut the sky,
chose to speak in a healers' tone instead.
I remind myself
of the violence it took
to become 
this gentle.
this cup of earth in my hands,
with home beneath
my fingernails.
I remind myself
what it means to be
pierced to the marrow
...

Read and leave comments (0)

🌷(2)

poetryrevelationinspirefeeljourneylove

: The Toss! :

The coin leapt up high above them.

And in it’s flight

The bright sunlight,

Made it glitter like a precious gem.

 

A lazy crawl to it’s apogee,

Then a shivering pause.

Which could be because,

The journey down has ‘gravity’!

 

Plummeting down from up so high,

It struck the loam.

Lost momentum

And opened a face to the sky.

 

The consequences are in the win...

Read and leave comments (0)

🌷(2)

PoetryTossAbstractinner thoughtscoin

AMBIGUITY

Ambiguity turns my wounds

into a stone punch.

And my chest is too old

to keep the painful sounds

within the beats

of my heart.

Ambiguity erodes my faith.

But in small acts of kindness

I somehow find a light of hope.

Sometimes I feel overwhelmed

with deep sadness

embedded deep down in my fate.

I still believe despite all the sadness

I believe that ambiguity w...

Read and leave comments (0)

🌷(4)

unknown feelingfeelingspoetry

what's that word again?

I've been in my feelings
and in my head for years.
I've built walls and
called them boundaries only
to wake up one day and realize
that I've boxed myself in

and that's the tragedy in it all;

in keeping myself safe
I've locked everything out.
and what a sad way to live,
peaceful and
picking my own muse 
to pieces until the only thing
left is
a bloody pile of 
everything I used to...

Read and leave comments (0)

🌷(5)

poetrysadlongingwritingdualityluggageshadow

on a thursday

i'm always the girl youre not sure about.
people have tried to make me
the girl you come back for.
but i want to be the girl
you never left.

and there are gaps in my happiness.
gaps in my teeth.
gaps in between breaths.
air, just...
slipping away.
fading away 
like colors on clothes
that have spent too much time
in the sun.

and what a funny way to say
theres always light in my l...

Read and leave comments (1)

🌷(6)

poetrylovesadthoughtful

If Galaxies Could Kiss

he never kissed me
goodbye.
there are no 
borrowed breaths 
bridging us,
no revival
on his lips.
just empty space
between memories
of when
there were no fireworks
and my feet
never leaving the ground.

Read and leave comments (0)

🌷(1)

poetrysepiaobscuresorrowdisappointment

A Universe Of Poetry

Merseyside poets have launched a free online anthology entitled 'A Universe Of Poetry'. The work is available to view on the Facebook platform, and will be part of a live upcoming event at the famous Bidston Observatory Artistic Research Centre on the Wirral Peninsula on August 15th this year.

Editors Barry Woods and Michelle Wright specifically curated the project for the observatory, with a t...

Read and leave comments (0)

BarryWoodsSpacePoetryUniverseMichelleWrightBidstonObservatory

Spaceminded

I’ve drifted in space,

In endless, boundless darkness, 

Escaping the allure of evil. 

Where sound fades away, 

yet voices still whisper, 

Silent screams echoing in the cold solitude,

Invisible to all, no matter how present I am, 

Like a symphony played in reverse or a piece of art unnoticed, 

Where time seems to crawl in slow motion,

Adrift in a single, unchanging direct...

Read and leave comments (2)

🌷(5)

mental health awarenesspoetry

Rust

I'm afraid I'll lose my edge
if I don't cut myself with it

afraid there's no proof
of my life
if it isn't pouring crimson

afraid that 
I'm living in vain if
I'm not
living in vein

Im afraid I'll lose my edge
if I don't cut myself with it

Read and leave comments (1)

🌷(8)

existentialpoetrybleedwriting

Spiritual Anima

human nature and
sympathetic sensitivity

parasitic

thought forms and will
manifest in woman and child

more so

than the inward hatred from a negative mentality

Read and leave comments (0)

animalnaturespiritspiritualspiritualitywriterpoempoetrypoetlovegodmetaphysics

Déjà vu & Phantasmagoria

— Recurring

crime seen in your eyes,
reflecting - eyelids
singed… deep, froze
and framed with pain
the negatives
of a photographic memory,
an outlook not unlike,
questioning, asking myself
what have I done?
what am I doing with my life?
what could I have done different?

Read and leave comments (0)

🌷(1)

crimethrillerlovepassionpoempoetrypoetwriternaturegodspiritualspiritualitymetaphysics

traffic & drugs

cats pests and insecticides
labrador dog breed
strands of
grass and dirt weed

Read and leave comments (0)

🌷(3)

cheech and chongmoviescriptpoempoetrypoetpoemslovenaturemetaphysicsweedcannabisdrugsgodspiritual

11:11

In the first second
infinite sensory overload
will begin, download it
and then this
thought process …
it is up to you to utilize
the central nervous system’s data

our own eye of the storm
strike like
lightning …
fast reflexes at the hands
of centered command

Read and leave comments (0)

11:11timeclockmagicspiritualnaturemetaphysicsgodpoetpoetrypoempoemswriterlove

reincarceration

serving consecutive life sentences
three meals,
the confines of jail time
three strikes,
and they are never letting you get out
they throw the book at you
like a caged animal
preying,
...as it lands on a page that says
a message from god
sins written on — listed off, and then
sent across the hall to your distant friend again

a life of recycling license plates
crime pays for the chip...

Read and leave comments (0)

U.S.AUSA4th of julypoetpoempoetrypoemsnaturemetaphysicsspiritualgodfireworks

Clothing Line

cut from a different cloth
dyed in the wool you pulled over your eyes

you made your bed now lie on it
tomorrow
is a wonderful day to die innit

I dress my wounds
and wear my heart on my sleeve
with cuff links & fingers crossed

Read and leave comments (0)

poempoetpoetrypoemsnaturemodelclothingfashiongodspiritualmetaphysics

Pandora's Box

Thought,

outside the realm of possibilities

Chaos …

beyond belief:

and great faith.

Read and leave comments (0)

greekgodspiritualmetaphysicsnaturegodpoempoetrypoetpoemsmythology

Divine Intervention

where did I put those car keys,
I think I have had one too many,
loss of memory —
and this
drug habit
has me... grabbing my head
trying to
get a grasp on my own sanity

Read and leave comments (0)

drugsalcoholsoberlovegodspiritualmetaphysicsnaturepoetpoetrypoempoems

questioning my destiny

In my study,
the test subject,
had to have
strands
of  this
genus’ genotype
“A” and be
exhibiting these abnormalities

Read and leave comments (0)

schoolNaturelovepoempoetrypoetmetaphysicsspiritualgodbeauty

: The Cup that Broke :

The cup that broke housed a thought.

                     A nascent bud, not blooming yet!

But the hand of chance with the pot,

                  Filled the cup with a different fate!

 

Smiling lips drank up the infusion.

                  Tho' the process of a nascent mind,

Failed to make that thought sustain!

                      A shattered cup was left behind!

Read and leave comments (0)

🌷(5)

Abstractpoetryrandom thinkingmusingsbroken

My Poetic Soul

I lost a rhyme

Somewhere in time 

One that nestled

In my soul

 

It left a scar

A dying star

Could not replace 

The light it stole

 

I searched my mind

But could not find

Why my soul

Set it free

 

Perhaps my sadness 

My internal madness 

Showed no joy

Would ever be

 

So, if one day

It should come your way

Give it my love

And regre...

Read and leave comments (8)

Poetry

Poem: Summer..

The scorching heat of Sun,

children playing in ponds and having fun.

The temperature may rise,

and if you are enjoying it.

You are also wise.

That is Summer!

 

The feel of blowing wind,

And because of the sweat,

our bodies get thinned.

and my sister’s flying hair.

And if we go out too much,

our skin gets dark from fair.

That is Summer!

 

In deserts it i...

Read and leave comments (0)

🌷(8)

poempoetrysummerNaturelifeStudent

Project Astral

remote viewing
a program,
telepathic visionaries
— channels
seers…
seen in a screening
recorded and reviewed

Read and leave comments (0)

🌷(3)

lovepoetpoetrypoemnaturegodspiritualityspiritualmetaphysicsoccult

Ghost Writer

dispelling of a curse
wards off
unknown entities
who try their hand at automatic writing

ghosts, haunters, 
“en animant” in specters
instruments crescendoing
as the light abandons us

no ones home,
signs that say to go away

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualspiritualityoccultmetaphysics

Scenarios

Every night i lie in bed

dozen scenarios in my head

thinkin bout how and what and when and where

every night you'll find me there

 

in my head

my secret place

in my mind 

my safest space

 

all those things i never find

confidence? 

i'd rather hide 

brave enough? not the case 

 

but in my mind 

my safest space 

 

i can be what i cannot

i can ...

Read and leave comments (0)

🌷(9)

love poemspoemspoetryoverthinkingcrush

Uncalculated Coitus

You touch me with your cold hands that have touched too many.

Finally making me feel seen and desirable.

As I gaze intently into your eyes, I notice you are not searching to see my soul.

You are simply seeing the face and lips that lie before you.

I hold hunger to be in your world, you only hold hunger to be in my body.

Although when you hold me tight, everything seems to be alrigh...

Read and leave comments (1)

🌷(5)

intercourseinsecuritiesromanticheartbreakbodyimagepoetry

Sweet Nothings

Queenship and Kingsman
The terms of endearment
scroll …
And, read through it

Except,
what’s in the fine print …

Maid of Honor …

If you would,
please …
As the left hand of the queen
swear your loyalty

Read and leave comments (0)

🌷(3)

poetpoetrypoemlovenaturespiritualspiritualitygodmetaphysicsoccult

Symbiosis of Broken Hearts

What is love?
Besides “A”
— a couple of
vowel sounds,
between U & I

ouïe?

Read and leave comments (0)

🌷(1)

poetpoetrypoemlovenaturegodspiritualitymetaphysicsmetaphysicaloccultspiritual

Entropy

Where has it brought me

To the point of hatred towards my own kin

Less in thought and more of it on me

Why do I hate my mother 

She’s taken my youth and discouraged my future 

Left to take hold of her addictions 

Copying what I know I don’t want 

So why do I carry on 

Doing things that I know resemble her

Cursed by a course of action

Product of a design 

Disgusted ...

Read and leave comments (1)

🌷(4)

poetrytoughlovelivingsoulwrenchingdiscoverymaternaltroublefamily

Star seeds ‘n’ the Cosmic egg - of life

Dewy lotuses, 
grow in the dark -
creating an entangling —
Flower of Life …

nature and everything — we know — has its roots
on the grounds of truth
indeed…
every family tree,
needs...
a tree house.

Habitats for Humanity  

There is a lone wolf
which is black,
and blue,
in the eyes :
whom sees the world differently
depending on —
whether or not you’re 
— on his or her good or...

Read and leave comments (0)

🌷(3)

birthdayhappybirthdayoccultmetaphysicsspiritualmetaphysicalnaturelovepoempoetrypoetspiritualitygodtruth

Nonet poem challenge

Beautiful leaf prints designed like hands   

 

Natural art, earth given plant

 

 Starts with a seed Nourished ,loved

 

Consistently cared for

 

The plant is you ,us 

 

Leaf print, hand print 

 

So unique 

 

We are

 

One

Read and leave comments (0)

🌷(4)

Nonetpoetry9

unachievable dreams

didn't wake up with the intention of being bad

I don't know why there's a pit in my stomach when no one is dead

run around my house and verbally beat up my dad

the screams sound bloodshed

 

he says, "there's so much you wanna do" 

and i obvert my eyes

wait around for a mental break-through

and make unachievable plans doing the highs

 

i wanna be a savior

and get th...

Read and leave comments (0)

🌷(4)

sadteenagegirlteenagerrelationship with parentsdepressionanxietypoetry

take the wheel

And venturing out
as an artisan model aircrafts
... enthusiast
is a larger than life recreation
to somebody
who
fell in love
with
Amelia Earhart's
figure 8

Read and leave comments (0)

naturelovevalentinesvalentinesdayspiritualspiritualitypoempoetrypoet

makeup sex

Ugh
Beauty standards ...
 
makeup your mind
you said you'd be ready
an hour past ...
you haven't changed at all
I'm leaving you
 
While i tease your hair,  suck it up
I'm head over heels in love

Read and leave comments (0)

beautymakeuplovenaturespiritualspiritualitypoempoetrypoetvalentinesvalentinesday

The Greatest Ever…. Cup and Ball Trick

The trick of the cup and ball 

Starts with a vanish and reappearance

From oranges, lemons and even a baseball

Teleport to a cup, that the audience cheer 

The magicians face says it all 

No wonder magic is a great career 

 

But instead of stopping he continues the act 

As he is now handcuffed, bound and strapped.

He repeats the words that makes himself... vanish once more...

Read and leave comments (2)

🌷(1)

magiccupandballtrickpoetryhumourShort Funny Poems

Wonka Land

Wonka land 

 

Have you seen the land of chocolate 

Just £35 from your own wallet 

Promises of wonkas factory delight

But actually it’s a cooperate warehouse of shite 

Ompa lumpars are large not tiny 

I look and stare and think christ almighty. 

 

Is it not Wonkaland? but another place 

As I think of an excuse to this disgrace

Willy Wonkas now here and he’s complete...

Read and leave comments (0)

🌷(1)

wonkalandwonkapoetryhumournews

the Good Book

generational forefathers
bore thine
fruits of their labor,

to an heiress

Oh, the burden
given to this poor mistook child.

the Fall of man—after death
40 days and 40 nights,
If we were to predate the Gregorian calendar
… spring too,
life—before Christ—dark
and light archangels
would earn their halos
from Helios through
sun worship,
during the 7 Days of Creation,
summer was mad...

Read and leave comments (0)

🌷(3)

godspiritualspiritualitynaturelovevalentinesvalentinevalentinesdaypoempoetrypoetwriterart

1000 MILES IN 2024: 1st Running Total

Thursday the eighth of February,

and eleven point seven miles I’ve walked,

a running total in defiance

of the enemy within,

of voices in my head who’d rather

I sit quiet, with nose to screen,

consuming crap made just for me,

algorhythmically designed

to rob me of humanity,

of poetry in my walking’s rhythm,

a miracle that’s in full flow,

performed by those who gave...

Read and leave comments (6)

🌷(5)

healthwealthwalkinghumanitypoetry

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message