Donations are essential to keep Write Out Loud going    

The Essence of Forgiveness

The Essence of Forgiveness

 

A tree slowly reaching out

its fullness only realised in time

Maturity spurs it to perfection

found when its full glory is attained

So the source of wisdom grows

deep within the human soul

Growth often hard and rugged

can with a moral sense espouse forgiveness

The completeness of the human soul

is a tree of grace and beauty to behold

...

Read and leave comments (2)

🌷(3)

Also by keith jeffries:

Nature´s Tunnel | The Other Mind | Auschwitz : Never Again | The Lament of a Technophobe | Aladdins Cave | A Family Gathering | One of many... | Nostalgia | A Dagger drawn | Darkness | The Lady of the House | The End Game | Time for a Change | When we die... | An Inspiring Landscape | Powerless | Here only for a while... | Passion | Dawn | Mushroom Picking | Befuddled | His Cherished Domain | A Frontier of Contrast | A Sad Memory | Quakers | Exodus | The Homeland | Shell Shock | The Beholder | A Mountain Journey | Immense Sorrow | Chemical Attack - Syria | Just after... | To be me | Sexuality | Apathy | Over the Moat | My Library | Astral Journey | The Mind Released | Passing Through | Holiday Makers | A Journey |

BORN AGAIN

Nothing seemed to comfort him

his troubled soul cried out for relief

 

then he heard a clarion call

offering a firm belief

 

born again ! born again !

never the same the same again

 

he was inducted

like lightning conducted

by Billy Graham's rally cry

 

ringing out ringing out

from uncertain ground to heavenly sky..

 

    "Billy Billy you are the bes...

Read and leave comments (3)

🌷(1)

Also by ray pool:

TIME FLIES, NOTHING CHANGES | AT THE WATERING HOLE | DESMOND HUGH ALOYSIUS | MOMENT OF TRUTH | SACRIFICE | PRINCE CHARLES's LAMENT | NORTH BY NORTHWEST | THE ELEPHANT IN THE GARDEN | TONGUE TWISTER | OLD POLITICIANS | HISTORIES AND MYSTERIES | NIGHT ERRORS |

Cont6.

If only you could see

That I'm crying

Deep inside

My lonely chest

If only you could know

That I am at fault

For all that has happened

Between us

If only you could hear

The sorrow in my voice

As I speak

As I breath

As I blink

As I listen

If you could only understand

Read and leave comments (0)

Also by Jason Phillips:

Cont5. | Cont4. | Cont3. | Cont2. | Cont. | Some new stuff |

The Comedy of Giants

The Comedy of Giants

 

     I once ran these hills without breaking a sweat,

And camped upon the summit of Englands tallest -

Singing punk lullabies at night, while

The stars danced merriment upon the eye,

     Those years were the personal victory

Of a boy who came from a town that only wanted

To cripple and belittle the shining ones;

To take away all that our elders fe...

Read and leave comments (0)

Also by Noetic-fret!:

Spite Britannia | She Rang To Inform You Of......... | Anniversary |

My past

I remember watching step-dad beating my mom
And him yelling at me in an alcohol breath
"If you say anything, I'll knock her down to death"
Being scared for her life of this ticking time bomb

Crying myself to sleep, almost daily routine
Wondering why my mom stayed paralzed to him
Wanting a helping hand out of this sadness grim
Trying to shake her up to quickly leave this scene

I was onl...

Read and leave comments (0)

Also by Louis Audet:

The new reality | The cleaning | Life as a puzzle | Attention | Drunken State | Escape Route | True Desire | The in-between | Sinking | The look that she gave me | The exotic beauty | Living with pain | The writer | True love hits | Night in Cuba | Best foot forward | Gardener and maid | Beautiful Bikini | Shading | Creepy old guy | My relaxation | Resort Fun | <untitled> | Forgiveness | The taking | Time is yours | Rainbow Love | There is no real justice | Création – Destruction |

Mine.

Illuminating circles of luminescent light caress the edges of your enticing form

The hues intensify in your eyes as colours contrast within your visionaries

Wrinkles form on the edges of your affectionaries, you are divine.

Scars run deeper than the darkest of deserted dreams

But you are mine.

Read and leave comments (0)

Grasping at straws

Grasping at straws, Reaching out to the stars.  We both have had flaws and Battle scars. Let nature take it"s course, I am willing to put this out in the universe for you to see and read, This is like first aid, we both need; As these hands layed. You are over there, I am over here, As I still care. Like they say come on in the water is fine,  as I add this to my vine.

Read and leave comments (0)

Also by Kenneth James Keller:

I am a writer | Lay me down to rest | I Bet | Flushed and Crushed | Desire | I have done all I can | You got to know | Fingertips | Just when you thought I Was Done |

Terrific Twins

Bursting with charisma
These two Kings of Rock n’ Roll
sure knew how to pull the heartstrings
and bring music to the soul

They rocked through every jailhouse
Left every hound dog all shook up
With gyrating hips and tempting lips
and eyes of cheeky pups

They synchronised their every move
added blends of looks and charm
The screams and faints awaiting them
caused authorities alarm

...

Read and leave comments (0)

Also by David Lindsay:

Crowese |

Elvis Presley

The Horrible Forest

There is a forest I do not like

You may not like it either

A forest far larger than any other.

 

No trick of words or meaning is employed here

It’s a real forest made of real trees

It has more trees than any other single forest.

 

A forest that stretches beyond every horizon

Vast is its cloak, prolific in the extreme

A forest unplanned, uncultivated, growing unchecked...

Read and leave comments (2)

The Cycle

You taught me that love is pain

and I believed you.

Now I'm grown

and I know

half the wounds I carry

aren't even my own.

Read and leave comments (0)

🌷(2)

Also by Melissa Gentile:

Bloom | Epidemic |

Morning After

small
rustle in the mid-hour

she moves
in steady comfort

bare shoulder to
restless sun

Read and leave comments (0)

🌷(1)

Also by A.M. Clarke:

Abscence |

i will love you at a far

Dear Tin

 

i will love you at a far

because no matter where you are

you will forever leave a scar

we went our seperate ways i see i took the wrong turn

i recollect the path i took straight to the tunnel

will that dimlight was darker than my life has been

you were the light to the end of that tunnel to my world

the sink was shipped and i got lost in the ocean without a re...

Read and leave comments (0)

exsunspokenwordslostlove

Let me tell you something

Let me tell you 
That the world is broken
That the rich have spoken
Let me tell you 
That there is no hope left
That the world has gone deaf
Let me tell you
That morals have vanished 
That people are famished 
Let me tell you
That we will always have tea 
That others aren't so lucky 
Let me tell you
That I've tried and failed 
That greed prevailed 
Let me tell you
That the mean hav...

Read and leave comments (1)

🌷(1)

Also by Wonderer:

Don't speak | Hard | Suspicion | The Garden | The Art of Cheating |

heading west (a candle burned at both ends)

awake again and seeing red

through midnight blue eyes swimming

in growing black pool pupils

 

--the groundhog sees his shadow

 

but mine never appears

though I know it follows

 

close behind, waiting for

the rising dawn to break the zenith

 

and mark the fall of another day.

Read and leave comments (4)

Also by nunya:

shedding light where angels fear to tread | selective mute | discontinuity | chalk one up | operation black sight |

Gossip's Arrow

someone somewhere 

has been saying

something about somebody.

 

someone's had too much

to say for themselves,

toxic words put into

other people's mouths 

 

that will spread 

like 'flu to every 

somebody else 

whose loose lips 

spill words like pub drunks.

 

someone is going 

to trip over 

a wagging tongue

and set free a cat 

from somebody els...

Read and leave comments (8)

🌷(6)

Also by Paul Waring:

Going Around In Circles | Fibs And Secrets | On Nights | Drop The Rope | Supermarket Space Invaders | Undress Rehearsal | Here's The Sting | Eggocentric | Queen of Camden | Cooper's Hill Cheese-Rolling | Being Someone Else | Jazz Notes, Harlem 1950's | Days Like This | Felling Us |

Vision Explorer

Imagination comes out of nowhere

landing inside a fantasy world

projects ideas into different images

let's you decide the direction

when flying off it leaves

a poem of your creation.

Read and leave comments (1)

🌷(1)

Without imagination I have no poem

Step Mother

With every breathe I take you drag me down,
With every second I spend awake you force me to drown.
In my sorrow.
In my wounds.
I wonder if there'll be a tomorrow.
I'm in love.
With a boy.
He completes me, makes spending the days with you.
Bearable.
Doable.
Lovable.
But with every breathe I take is a fighting one.
Like two arms pulling me apart.
I wonder if he sees the pain that lies u...

Read and leave comments (0)

Also by Hannah Orosco:

A Vision of Love | Falling for a Girl (Man's POV) | Exposed | Working Man By: My Best Friend Waylon <3 | Nothing | Stillest Point | Your Touch | Colors | Her | The Beauty | The Deep Darkness | Little Sister Hush Hush | Ugly Words | The Missing Piece | Daddy's Little Princess |

StayingStrong

Death Brought Us Closer

Death brings us closer #25

 

The only connection I truly had with this young man was the darkness that beholds us both,

He could speak with such talent and such words, you would think it was a bible oath,

This young, charming and daring man was a fighter,

However, all fights but come to an end,

In his case, it was the end, however, I will remember this, and I will defend,

Defe...

Read and leave comments (0)

Also by Samual Jake:

Death Part II | my webiste | Lie & Run | Dormant | Dont Quit | I Lied | Manic | Lovers or Friends? | Bipolar & My Brother |

deathfriendshipbipolarsuicide

take the darkness of this world and make it light

after three beers you saw the clouds for what they were

white letters on a pale blue background

but there is something inside you

something slick, metallic and unrecognisable

it comes up when you speak of your father

or when you hear the works of erik satie

 

you showed me how to plug your ears

so that the screaming turned to the whisper of the sea

a rattling wheeze stuc...

Read and leave comments (5)

🌷(5)

Also by Stuart Buck:

after reading the bible, naked and afraid | what god has joined together let no man put asunder | to sea at last |

Losing you

Today I realised I had walked away,
Today I know I still care,
But today I know I did the right thing.

Tommorow I won't forget you,
Tommorow I wouldn't shun you,
But tommorow I wouldn't call on you.

Yesterday I was angry,
Yesterday I wanted to forget,
But yesterday can't be erased.

My future wasn't meant to be with you,
My future is my motivation to move forward,
But my future won...

Read and leave comments (3)

THE END OF THE AFFAIR

 

For forty four years since I was a lad

I’ve voted for Labour just like my dad;

 

When Labour was Old and when Labour was New

We voted for Wilson and Callaghan’s crew

For Foot and for Blair and for Miliband too.

 

For while Labour was proud and once a broad church

It welcomed allcomers which made it so strong;

It’s now more exclusive and leftwards it’s lurched

I’m...

Read and leave comments (7)

Also by John Coopey:

KKK | NO MORE DOGGIN' | WRONG ROAD ROUN' - AN URBAN VILLANELLE | SAMMY B GOODE | MANBOOBS |

On A Good Morning

 

    Under my pillow the whispering heart of Simone Weil
expresses sweet love better than I could ever hope to.
Please don't wake me only to face the day empty-handed.

    Under my pillow beaks Mozart among the nightingales;
sweet message of the soaring song at last loud and clear.
Don't wake me for surely I will come away with nothing.

    Under my pillow the fierce red eyes of the ...

Read and leave comments (0)

Also by Adam Whitworth:

Private Poems | Called Back To The Sea | Against Chaos | In Consequence Of Love | (untitled) | A Four-Letter Word? | Before The Angels | (untitled) |

Momentary Musings

My mind has been released on bail

pending further enquiries.

Liberated, it walks with me

through the gates and onto the streets

but before wandering further 

 

it surveys, just for a minute -

the football game in the alley,

the blackbird's therapeutic chirp,

the slowly trickling riverbed,

the sky awash in orange-red.

 

It feels a multitude of things - 

Weary,...

Read and leave comments (3)

🌷(5)

Also by Neil Robertson:

Under a Different Cloud | I, Once Removed | Truck | Shopping List | Rowing |

Shroedinger's Poet

It is a curse

To have a flying soul

And a cinderblock mind

To feel the call of the sky

But to be afraid of heights

 

I am Schrödinger's cat

Alive and dead

At the same time

Read and leave comments (1)

🌷(6)

Also by A Brady:

Yet Still I Run | Who I am Becoming | Why I Do Not Want to Hear That You Love Me |

catshroedingercinderblockmindheightsalivedeadskyflying soulsoulafraid of heightsat the same timealive and dead

Reverse

Love never captures the stars 
for we burn in the hollow 
of the black hole 
tearing at our souls. 

Yearning to be free, 
on our knees, we plead, 
blind at times in defeat,
deaf to the trees, 
the hearts true needs 

but on we climb toward the light, 
the rainbow an illusion of mind 
knowing the journey is the gold, 
that truth comes in numbers
and in reverse the future unfolds.

...

Read and leave comments (1)

🌷(2)

Also by MyDystopiA:

Half Moon | Will | Hurricane | Sunday | Rope |

defeatillusionlife's journeyloveyearning

Lies

Lies

 

 

the world you lived in as a child

was small enough for small beliefs

the healing power of ice cream

miracles that mended toys

and a mother whose hands could wipe away

tear stained pain

 

but I cannot mend

this man

your father

 

no promises

no medicine

no magic

will make him breathe again

 

you are taller than me now

a soldier

...

Read and leave comments (4)

🌷(9)

Also by Karen Ankers:

On Parade | Left Behind | Hero | David | Unseen |

Dirt

1.      Dirt

Staring down at three fresh mounds of soil

Rain running down the collar of my shirt

Tears gently rolling down across my cheeks

As I stare uncomprehending at the dirt

 

Three lives gone, taken from me forever

Leaving behind, a shell of a man and a mountain of hurt

Lost in my memories and my inner thoughts

Staring blankly at the freshly turned dirt

 

I s...

Read and leave comments (0)

Also by Andy Smyth:

My basement empire | Shopping and When I've Gone | Inspiration | I Wish | My Garden | On a Train | Poetic licence | Milestone |

Thoughtful

Lost

The more I go

The darker it gets

Doesn't matter what is my choice

It's always the wrong one

I missed all the tracks

But there is no survivor left in me

I wish I was the never ending story

That at least came to end.

Read and leave comments (0)

🌷(1)

lostlonelylonelessanxietypoetrydepressionfeelingway

Change

Change

The rain is falling now,

it cleanses the sorrow.

 

Shades of brown and blue,

painful thoughts are pushing through.

The agony rises and tears like a saw,

the horizon is shallow but reaps so raw.

 

Wait. Wait. Will change come soon?

Trials of life are my boon.

Experiences are plentiful,

wisdom now soars while deafining silence counters.

 

We sought no...

Read and leave comments (2)

Also by Larry Smith:

Chimes | Affirmation | Why can't I see you? | Land of Dreams | Time's Up | Suffering |

Ghosts

I'm my mind I go back to the rim of the big canyon that I spent so much time at as a child. 
I can vividly see how it looked back then, the sage brush and cedars blowing gently in the wind. 
I can smell the dust and the vegetation that surrounds you always in this place. 
I can remember the deer running in the bottom of the canyon. 
I can hear my grandpa as we sit there telling me stories and ...

Read and leave comments (0)

Also by Jeffrey McGehee:

Self Perception | The Morning | Brilliance of the sun |

Seduction

Awakening and rekindling
The exhilarating experience
Of being a cherished object
Of love and desire
With a flattering affectionate look
"Other than you I have
No beauty to admire!"
Fanning the ember of
An emotionally not-checked-in
Wife's lady hood in to a fire
I put off her attire
To enjoy a forbidden fruit
I never imagined
I could  succeed to acquire!

The girl who shunned me
Pre...

Read and leave comments (0)

To victims of infidelitydestructive affair

It Was Similar To The Resurrection Oh But Not The Same

it was similar to the resurrection
oh but not the same..
i overheard a mother qualify and explain
something about their
miraculously risen cat..

the mother zoned-in on my baffled expression snagged
and within her reflection she gently flung 
she culled and hulled and duffed my air
then away into the supermarket she burned
her piety affronted 
and there morphed aglow 
an angry mumsnet ...

Read and leave comments (11)

🌷(5)

Also by Suki Spangles:

Escape To Easter Island A Gated Community |

Hitting the Wrong Note

Hitting the Wrong Note

 

Rooted next to his upright piano,

close in the tiny room,

I couldn't breathe.

He held one hand

to the small of my back,

the other across my

taut diaphragm:

 

(I can believe he loved

the music, but he craved

only angels, expected them -

and, by God, he was

going to have them,

even if he clipped

their wings along the way).

 

...

Read and leave comments (5)

🌷(5)

Also by David Redfield:

Essay: poetry & the screen |

childhood memories

and there he was, so perfect and handsome. big brown eyes staring at me like i was the most beautiful thing he's ever seen. i hope for him to look at me like that forever, and to kiss me like the sun kisses the ocean every night.

                              ~for you 

  

Read and leave comments (0)

Rzhepiks (something funny)

And in the refrigerator at night

Food is more useful and right

                    ***

Nothing is forever under the star

Started my doctor from afar

                    ***

About alcohol - I know my norm as such

But I can’t drink so much

                     ***

You are very chained by  brain

Let me loosen the chain

                  ***

Olga's heart is made of ...

Read and leave comments (2)

humour

Vanishing Point

When I was a man leaning against walls

and that was all I did with my day, the walls:

pebble-dashed, bricked, wood -

I was just a man that leant against walls.

 

At some point something changed and I ceased

to be a man who leant against walls and more

of a man that salted cucumbers.

 

The cucumbers would arrive in packs of ten

and, with method, I would apply the salt,

...

Read and leave comments (1)

🌷(1)

The sun on the Tyne is all mine, oh mine (A Premier tribute to Geordieland!)

They’re off…

Malcolm on the ball. Big Mac does his trademark shimmy and slips in a slick pass to Cheryl.

Well we all know she has the X Factor and after a few precious yards lofts it to Kurly-Haired Keegan.

 KK as we known him weaves his magic, taking one, two, three defenders with him.

Sets up Kate who is rather slow on the left wing. Bless her, our Ms. Adie. She has served club and c...

Read and leave comments (1)

🌷(1)

Also by Chakraj:

Meet Fear, my new friend. |

Can Some One Please Help

I need some help with my poem. I am new at this and I would be ever so thankful if some one could give me some feed back at what I have so far. Thank you. 

Death, Depresion, Demise,
Oh there are so many other words that can be used,
Prettier and more beautiful words in our languege,
Yet i find myself becomeing attached to theses words,
Clutching to them like my life depended on it.
But, ma...

Read and leave comments (3)

6 x Short Poems wrote while watching the film 'The Sense of an ending')

(I)

Your eyes linger
In a pause
Before dissolving into black.

(II)

Taking some time out
Your diary misses day out
Almost like it has a mind of its own.

(III)

Not being familiar with Dylan Thomas’s work
You are happy drinking
Your own masterpieces.

(IV)

Counting shadows
Postcards carry feelings
Whether at the beginning
Of the end of the journey.

(V)

Closing circl...

Read and leave comments (4)

🌷(1)

Also by Andy N:

Ghost Story IV (Part XXII) | Dawn of the Election | Sweet Nothings (A Homage to Hugo Williams's poem of the same name) | The Swan (After Mary Oliver) | Ghost Story IV (Napwrimo blog) |

Your Chain Hangs From My Rear-View Mirror

Your chain hangs from my rear-view mirror
Swinging and swaying with every turn i take
Your chain hangs from my rear-view mirror
Untouched, unwanted, unable to take it down
Your chain hangs from my rear-view mirror
A reminder of how things used to be
Your chain hangs from my rear-view mirror
Testing my patience and strength
Your chain hangs from my rear-view mirror
Looked passed and ignore...

Read and leave comments (2)

🌷(1)

Hope

Yesterday, the sun shone black upon my soul

Depth's depth deep beneath my heart.

Lumined ne'er by hope

Thoughts sank weighted low

 

Today, dawn'd, in heaven's mantle rais'd,

Glims golden future in my mind.

Light lightened all by future faith

Heart, mind and soul exalting up

 

Her voice love levered up, returned it from the depths

Dark voids where happiness was stra...

Read and leave comments (0)

Also by Chris Armstrong:

Nant Lluest-Fach |

despairfuturehopelosspast

A poem for you

I look at the sun each day 

Wondering how my life could have been differant 

Walking on paths, and thinking, which way 

All of them seem gloomy none of them magnificent 

As tears roll down my face 

Wishing I knew what to do 

The struggle in each breath I take 

Its not as easy as it looks 

Nothing is as easy as it looks 

But determination I used 

My feelings could have...

Read and leave comments (0)

🌷(3)

Get a Life

'Get a life' They said. So I did

I stopped saving my time in the bank of 'one day'  

I stopped snatching moments and looking forward to five minutes peace

I started spending my time

I spent it generously

As if I was the time millionaire

I spent hours freely gazing at the stars

Wrapped in blanket, mug of tea warming my hands

Watching the flames from a garden fire fly heaven ...

Read and leave comments (4)

🌷(6)

Also by Hazel ettridge:

Doggerel (I'm trying everything) |

When We Were Seventeen

You asked if this was okay

But I didn't have the heart to tell you the truth

didn't possess the words to say 

no

this is so much more 

It just didn't seem to roll off my tongue the way mine rolled over yours

There wasn't enough time to explain the feeling of innocent euphoria I experienced with you 

No way to begin to illustrate how you made me unravel at the seams like lillie...

Read and leave comments (2)

🌷(4)

Also by Cait Abbott:

Bittersweet | Young | Belief | Since Yesterday | Do you hear me now? |

loverelationshipsyoung loveyouth

Logic

If Logic's the theory of proof 

And Inferences a process to truth 

Then it's impossible to state 

A premise, then negate 

The conclusion 

Unless it's a spoof. 

 

words and foto T Carroll 

Read and leave comments (2)

🌷(2)

Also by Tommy Carroll:

Sin |

My pen

I will eviscerate you with my pen

Your blood will be as ink

Pumping

Dripping

Blotching the paper

I will write your life

Put down black upon white

No part spared or left out

As the very soul of you revealed

Every soaking last drip

Until the ink runs dry

And you can no longer speak

Or insinuate another lie

Read and leave comments (6)

🌷(4)

Also by Martin Elder:

let us talk | Robbers tongue |

am i selfish?

Note: there is some strong language in this. it's not too bad. it's not too excessive, either. one word in here twice, i think. and if you're wondering, yes, the colors mean something. and yes, im genuinely asking a question to you, the reader. and to the person this is about. but i pray he never reads or finds this. anyway, enjoy.

 

Am I selfish for wanting another hug? 

I handed you the...

Read and leave comments (3)

Also by m.k.:

will blue turn into purple? |

bad friendsbad poetrycolorsdepressiondoubtfatherhigh schoolhopeinsecuritieslovemotherneednightmaresplatonic lovesadschoolsuicidesuicide note?supportteacherwant

It

Ah … the primitive id

buried drive of sex and aggression

so thinly civilized

our basic Beast growling

claw flexing, eye fixing

ready to pounce

in dreams

slips of the tongue

flashing anger

free association

 

In Art -

shadows in a painting

tone of a story

plumb stone of a poem

architect's angles

bass pacing heart beat -

subplots in metaphor

...

Read and leave comments (4)

🌷(3)

Also by Cynthia Buell Thomas:

Garden Party | Girl in a Lake |

Bloom

Roses are red violets are blue ah just kidding that's not how I start off a poem for you, you hair is like silk, your lips like no other, your eyes they give off a sensation of wonder, a true work of art, you are the kaleidoscope piece to my heart, for your love is shiny, colorful, and always brand new, I'm your sweet loving pet but you're just as loyal and true. 

Read and leave comments (0)

🌷(1)

Also by Myescape:

Accepting flaws | Skinned | Drizzling |

lovekissing

She seemed down today

        I.            Tortured by her own behaviour

      II.            Rivalry expressed through lovers’ soul

    III.            Battling for humbleness to be the change in her,

    IV.            Prior days has depicted her deepest love

      V.            But reality dreams, of fear is all she has to take hold of.

 

    VI.            She has a generous guilt for society inf...

Read and leave comments (0)

Show more entries …

This site uses cookies. By continuing to browse, you are agreeing to our use of cookies.

Find out more Hide this message